(data stored in ACNUC7421 zone)

EMBL: CR954246.PE33

CR954246.PE33        Location/Qualifiers
FT   CDS_pept        complement(34002..34541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0033"
FT                   /product="putative carbonic anhydrase/acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85147"
FT                   /db_xref="GOA:Q3IDI4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI4"
FT                   /protein_id="CAI85147.1"
FT                   /translation="MTIRSYKGVIPSFNASVYIDESSVLVGDITLGDDSSVWPLVAARG
FT                   DVNYIRIGERTNIQDGSVLHLSRATKSNPEGYPLIIGDDVTVGHKVMLHGCQLGNRILV
FT                   GMGAIIMDNAIVEDNVIIGGGSLVPPNKRLESGYLYVGSPVKQARALTEQELTFLKVSA
FT                   DNYVLLKNEYLSDDVI"
     atgacaatcc gttcttataa aggtgttatc ccttcattta atgcgtctgt ttatatagat        60
     gaatcatcgg tattggttgg cgatattact ttgggtgatg atagcagcgt gtggccgtta       120
     gttgctgccc gtggtgatgt aaactatata cgcattggtg agcgtactaa tatacaagat       180
     ggtagcgtgc tgcatttatc gcgagcaacc aaaagtaacc ccgaaggtta tccgcttata       240
     attggtgatg atgtaacggt tgggcacaaa gttatgttac atggttgtca gttaggtaat       300
     cgtatattgg tgggaatggg cgcaattatt atggacaatg ccattgttga agataatgtg       360
     attattggcg ggggttcatt ggtgccacca aataagcgtt tggagtctgg ttacttatat       420
     gtaggcagtc cagttaagca agctcgagcg cttaccgagc aagagcttac atttttaaaa       480
     gtatctgcgg ataactatgt actgcttaaa aatgagtact taagtgacga cgttatataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page