(data stored in ACNUC7421 zone)

EMBL: CR954246.PE335

CR954246.PE335       Location/Qualifiers
FT   CDS_pept        complement(365785..366189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0351"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85449"
FT                   /db_xref="GOA:Q3IIB7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB7"
FT                   /protein_id="CAI85449.1"
FT                   /translation="MRAKDKLRLNPIRMVLAEVMKREKDEQITLDDAGITSVIVKLVKQ
FT                   RRDSYTQYKDAGRDDLADIEANEIVALETFLPQKLSEEEIIALIDAAIADTNAAGMQDM
FT                   GKVMGIIKSKAEGRADMGKISGLIKQRLTA"
     atgagagcca aagacaaatt acgtcttaac cctattcgca tggtacttgc tgaagtcatg        60
     aaacgtgaaa aagacgagca aataacacta gacgacgcag gtattacctc cgttatagtg       120
     aagcttgtta aacaacgtcg tgactcttac actcagtaca aagatgctgg gcgtgatgat       180
     ttagctgata ttgaagccaa tgaaatagta gcacttgaaa ctttcttacc tcaaaaattg       240
     agtgaagaag aaataattgc tctcattgat gcggctattg ctgacactaa cgcagcaggt       300
     atgcaagaca tgggtaaagt aatgggtata atcaaaagca aagctgaagg tcgcgccgat       360
     atgggcaaaa tctctggttt aattaagcaa cgattaacag cctag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page