(data stored in ACNUC7421 zone)

EMBL: CR954246.PE337

CR954246.PE337       Location/Qualifiers
FT   CDS_pept        complement(366612..367217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0353"
FT                   /product="putative enzyme with N-6 Adenine-specific DNA
FT                   methylase domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85451"
FT                   /db_xref="GOA:Q3IIB5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB5"
FT                   /protein_id="CAI85451.1"
FT                   /translation="MRKKTTQNKVTSKSSDGFIRVISGQFRGRKLPVKDVQGLRPTTDR
FT                   IKETVFNWLMQDTREANVLDCFAGSGGLGFEALSRFAKSATFVELDAAAAKQIELNIST
FT                   LKLQNAHVKHTNTLAFLEQINSNEPFNLVFVDPPFRKNLAQSSADLLENNQWLSSDALI
FT                   YIEVESELSTFTAPINWLLIKEKKAGQVFCRLYQRQVN"
     atgagaaaaa aaacaacgca aaataaagta actagcaaat ccagcgatgg ctttattaga        60
     gtgatcagtg gccaatttag aggccgaaag ctgcccgtca aagacgtaca agggctgcgc       120
     ccaacaactg atcgtataaa agaaacagtg tttaattggt taatgcaaga tacccgagag       180
     gcaaatgtgc tcgactgttt tgccggttct ggcggtttag gttttgaggc gctgtcacga       240
     tttgctaaaa gcgctacttt tgttgaactt gacgctgccg cagcaaagca aattgagcta       300
     aacattagta ctttaaagct gcaaaacgca cacgtaaaac ataccaatac actggcattt       360
     ttagagcaaa ttaatagtaa tgagccattt aatctagttt ttgttgaccc gccatttcgt       420
     aaaaacttgg cacaatcgag cgctgattta ctagaaaaca atcaatggct aagcagtgac       480
     gctttaattt acattgaggt ggaaagcgag ttaagcacct ttactgcacc aatcaactgg       540
     ttgttaatta aagaaaaaaa ggctgggcaa gttttttgtc gtttgtatca acgccaagta       600
     aattaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page