(data stored in ACNUC7421 zone)

EMBL: CR954246.PE34

CR954246.PE34        Location/Qualifiers
FT   CDS_pept        40991..41923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0038"
FT                   /product="putative lipoprotein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85148"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ46"
FT                   /protein_id="CAI85148.1"
FT                   /translation="MSNIKAWKLLSLFCLFAVLMGCQSKEEQLQKTIQESIKKAEVELS
FT                   QLGTALDNGSLRNALLLKEYGVQLKNQQPELSKVVDVITLDATRQGALYSGLTQRLKDI
FT                   KGTYLIPPYEDTLHSIDLLREAAKPTLFSDALTDPINMLADMSKGNLARIGAISQQAEG
FT                   AGVGNQMVGNPNYGNWQSNSNGTSFWQWYGMYRILGDVFNRVEYGSWSRGRKYSYYNDY
FT                   GRTRYSSPKQIKAQSTLETRTRQSYQRQGKQFTSPYASKKTGASGLSRSSYTPPKSRSS
FT                   YSRSSSYSNNSGSVRNSGSRTSRGVSRGK"
     atgtcaaata ttaaagcttg gaaacttctc agcctgtttt gtttgtttgc ggtgcttatg        60
     ggttgccaat ctaaagaaga gcaactgcaa aaaacaattc aagaatcgat taaaaaagcg       120
     gaggttgagc tatcacagct aggtactgcg cttgataatg gtagtttgcg taatgcatta       180
     ttacttaaag aatacggtgt tcagcttaaa aatcagcaac cagaactttc aaaagttgtt       240
     gatgtcatta cccttgacgc cactcgtcaa ggtgcacttt atagtggttt aacacagcga       300
     cttaaagata ttaagggcac ctaccttatt cctccttacg aagatacttt gcacagtatt       360
     gacttattgc gcgaagctgc aaagcctacg ttattttcag atgcgttaac cgatcctatt       420
     aatatgcttg cggatatgtc taaaggtaat ttagcgcgta ttggtgctat tagtcagcaa       480
     gctgaaggcg ctggagttgg taaccaaatg gtgggtaatc ctaattatgg taactggcaa       540
     tctaacagca atggtactag cttttggcaa tggtacggta tgtatcgtat tttaggggat       600
     gtattcaatc gtgttgaata tggtagctgg agccgaggtc gtaaatatag ttattacaat       660
     gattacggcc gcacgcgcta ctcaagccca aaacaaatta aagcgcagag cacgctagaa       720
     acacgtacgc gtcaatcata tcaacgccaa ggtaagcagt ttactagccc ttatgcgagc       780
     aaaaaaacgg gggcgtcagg cttaagccga agtagctaca caccacctaa aagtcgcagt       840
     agttattctc gttcgagtag ttatagcaat aactcgggct cagttcgtaa cagcggtagt       900
     agaacctctc gtggcgtgag ccgtggtaag taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page