(data stored in ACNUC7421 zone)

EMBL: CR954246.PE342

CR954246.PE342       Location/Qualifiers
FT   CDS_pept        complement(372508..373344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0358"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85456"
FT                   /db_xref="GOA:Q3IIB0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB0"
FT                   /protein_id="CAI85456.1"
FT                   /translation="MIKDILLHPVLISVVVLTIAFSLKVLVDKLARYRAEKKEKDTRYI
FT                   AHNIKHFINFTMVLLLLFIWSTEIQNFALSIAAFAVAIVLATREFIQCVIGFFYLVTTR
FT                   PFRIGDWVQVGEYYGEVAETNWIKTTLHEIDMRTYQFSRKTIFIPNNKLITSPIKNLNF
FT                   VKRFATHHFNIVRKDSFNPYPIYETLRNKAKHYCEEFEEVASRYNSIIERKLDAKISGP
FT                   EPEIHFGTTELGEFRASFTLFCPTDKALEIEHKLTECFMELWYSEATKSDVQSKIT"
     atgatcaaag atatactact acacccagtt cttatctcag tggtggtgct cactatcgca        60
     tttagtttaa aagtacttgt tgataagttg gcgcgatata gagcagaaaa aaaagaaaaa       120
     gatactcgct acattgcaca caatattaag cactttatta actttactat ggttttgtta       180
     ctgctgttta tatggtcgac tgagattcaa aactttgcac tgtctatagc cgcttttgcc       240
     gttgctattg tgcttgccac tagagagttt attcagtgtg taattggctt tttttactta       300
     gtaacaaccc gcccatttag aattggcgac tgggtacaag ttggtgaata ttatggcgaa       360
     gtagcagaga ccaattggat taaaaccacc ttacatgaaa ttgatatgcg aacttatcaa       420
     ttctctagaa aaacaatatt tattcctaat aacaaattaa ttaccagccc aataaaaaac       480
     ttaaactttg ttaaacgctt tgctactcat cattttaata ttgtgcgtaa agacagcttt       540
     aatccgtacc ctatttacga aactcttcgc aataaagcca agcattactg cgaagagttt       600
     gaagaagtgg cgagccggta taactctatt atcgaaagaa aattagatgc aaaaatttca       660
     ggcccagaac ccgagattca ctttggtact actgagttag gagaatttag agcaagcttc       720
     accctatttt gcccaaccga taaagcactt gaaatagaac ataagttaac tgaatgcttt       780
     atggagctgt ggtatagcga agcaactaaa agtgatgtgc aaagcaaaat cacttag          837
//

If you have problems or comments...

PBIL Back to PBIL home page