(data stored in ACNUC7421 zone)

EMBL: CR954246.PE343

CR954246.PE343       Location/Qualifiers
FT   CDS_pept        complement(373436..374068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0359"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85457"
FT                   /db_xref="GOA:Q3IIA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA9"
FT                   /protein_id="CAI85457.1"
FT                   /translation="MFLLRSLIYLLCLAGVASLIQLEGFELQQNALYSEETLTEHMQDI
FT                   LTFLSAILFFYASRISPKLKVASVLLAALTAMMFVREFDTYLDMYVFDGAWQTIVYSIL
FT                   ACTFVYLIRKRGTIFSSIQAYTQTPSYGICLSGLVTLLAFSRIMGRGEFWHSIMGESYV
FT                   RIVKNIVEEGIETLGYTLILISAIELILLCRKQLNKQHHHVGNGVTD"
     atgtttttac tacgatcttt gatttactta ttatgcttag ctggtgttgc ctcattaatt        60
     cagcttgaag gctttgaatt acagcaaaat gcactttata gcgaagaaac actcactgag       120
     cacatgcaag atattttaac ttttttaagt gctattttgt ttttttacgc ctcacgtatt       180
     agcccgaaac ttaaggtagc ttcggtatta cttgctgctc taacagcaat gatgtttgta       240
     agagaatttg atacatacct tgatatgtat gtttttgatg gcgcctggca aactatcgtt       300
     tattcaatac ttgcttgtac atttgtttac ctaataagaa aaagagggac tatttttagc       360
     tccatccaag cctatactca aacaccaagt tatggcattt gcttatctgg cttggttacg       420
     ttgttagctt tttctcgcat tatgggcaga ggtgaatttt ggcactctat tatgggtgag       480
     agctacgtgc gtatagttaa aaacattgta gaagaaggga tagaaacact tggttatact       540
     ttaattttaa tttcagctat tgagcttata cttttgtgtc gtaaacagct taataaacag       600
     catcaccatg ttggcaatgg agtaactgac taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page