(data stored in ACNUC7421 zone)

EMBL: CR954246.PE346

CR954246.PE346       Location/Qualifiers
FT   CDS_pept        378159..378917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0362"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85460"
FT                   /db_xref="GOA:Q3IIA6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIA6"
FT                   /protein_id="CAI85460.1"
FT                   /translation="MVIKCAFKECRPYLNELETRFGLAHWADQSSGFSLHYDDTGLSLY
FT                   KTDEPKLGAISVDFVTGAAAHRRKFGGGKGQAIAKAVGLNKGATPIVLDATAGLGRDGF
FT                   VLASLGCKVILHERHPVVAALLYDGLQRAYNDIEIGPWMQQNMSLIFGSSHTLLAQCES
FT                   MPDVVYLDPMFPHREKSALVKKEMRVFQDLVGADTDADDLLEFAYPLASKRVVVKRPDY
FT                   APFLNDKTPSMQIKTKKNRFDVYVKAAMKK"
     gtggttatta agtgtgcctt taaagaatgc cgtccttatt taaatgagtt agaaacacgt        60
     tttggcttag cccattgggc agatcaaagc agtggtttta gcctgcatta cgacgataca       120
     ggcctgagct tatataaaac cgatgagcct aaactaggcg caataagcgt tgactttgtt       180
     acgggcgctg cagcgcacag acgaaagttt ggcggcggta aaggccaagc aattgccaaa       240
     gcagtaggct taaataaagg ggcgactcct atagtcctcg acgccaccgc agggctagga       300
     cgtgatggtt ttgtattagc gtcgcttggt tgtaaagtaa tattgcacga acgccacccc       360
     gtagttgcag cacttttata cgatggccta cagcgcgcat acaacgacat tgaaattggt       420
     ccgtggatgc agcaaaacat gagcctaata tttggctcaa gccatacctt acttgctcaa       480
     tgcgaaagca tgccagatgt agtttactta gatcctatgt ttccgcatcg cgaaaaatca       540
     gccttagtta aaaaagaaat gcgcgtattt caagacttag taggcgccga caccgacgcc       600
     gacgatttac tcgaatttgc ctacccactt gccagtaagc gcgtggtagt aaagcgcccc       660
     gattacgccc catttttaaa cgacaaaact cctagcatgc aaattaaaac gaaaaaaaac       720
     cgcttcgacg tatatgtaaa agctgcgatg aaaaagtaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page