(data stored in ACNUC7421 zone)

EMBL: CR954246.PE347

CR954246.PE347       Location/Qualifiers
FT   CDS_pept        complement(379115..379855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0363"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85461"
FT                   /db_xref="GOA:Q3IIA5"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA5"
FT                   /protein_id="CAI85461.1"
FT                   /translation="MKVIIGLILMLGFASLNAKAKQIAIVIDDIGYHQRDLELLTLPGQ
FT                   VSYSILPHTPYAQAFATLASKTNKELLLHIPMQALNGKELGPGALTLNMNKEQIQQILG
FT                   TALASLPQVKGVNNHMGSALTQQSQAMRWIMEVLKKRHLYFLDSRTTELSQAQNAANFL
FT                   GVENIGRHIFLDNITTPEQLQLRLDELKQHATEHKFAIAIAHPYPETIAFLRHVLPQLS
FT                   KQGFELVPVSKLVERKYIQLAEKY"
     atgaaagtaa ttatagggct gatattgatg cttggttttg cgtcactcaa tgctaaagcc        60
     aagcaaatag cgatagtaat agacgacata ggctatcacc agagagattt agaactgtta       120
     actttgcctg gccaagtgtc gtattcaatt ttgcctcaca cgccttatgc acaagctttt       180
     gccactttag ccagtaaaac aaataaagag ttattactgc atattcccat gcaagcactt       240
     aacggcaagg agcttggccc tggcgcactt acgttaaata tgaataaaga gcagatacag       300
     caaatacttg gcactgcttt ggccagttta ccgcaagtta aaggggttaa taatcacatg       360
     ggatcggcgc tcacccagca aagccaagct atgaggtgga taatggaagt gcttaaaaag       420
     cgacatttgt actttttaga tagccgcacc actgaattaa gccaggcaca aaatgccgct       480
     aactttttag gtgttgaaaa tattggccgt catatttttt tagataacat aaccacacca       540
     gaacagttac aactgcgcct agatgagcta aaacaacacg ctactgagca taagtttgcc       600
     attgcaattg cccaccccta ccctgaaaca atcgcgtttt tacgccacgt tttaccacag       660
     ctcagcaaac aaggttttga attagtaccc gtatctaagc tggtagagcg taaatatata       720
     caactggcag agaagtacta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page