(data stored in ACNUC7421 zone)

EMBL: CR954246.PE348

CR954246.PE348       Location/Qualifiers
FT   CDS_pept        complement(379928..381193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0364"
FT                   /product="putative carboxyl-terminal protease"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.102"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85462"
FT                   /db_xref="GOA:Q3IIA4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA4"
FT                   /protein_id="CAI85462.1"
FT                   /translation="MDKKSTVAKWFKNTGFTLNLSLYLLALFVFISFSANVFSSSIKEL
FT                   KSQQITEILFNIHTYYVEDLALQNTTHTSYNNQQFAHLYAQLDPYSKYLDEHELNALFD
FT                   NTNGRYTGLGIEVKQINNNVTIVNVVNNSPAKSAGVMAGDIIINVNNQTTQHSSVEHVA
FT                   QLITASKLSNISLTIKRDNQPQPLNFNVSRRKIKLESVTSQRLDLGCGYLAINSFSNHT
FT                   LHEVALQIAAMQNHFGDPLKGLVIDLRDNPGGTLRSAVAVSDLFLQNGTIVTTKGRYNE
FT                   ANKAFYAKHGDILKGAPIVVLINENSASAAEILAAALKDNNRAKVVGSQSFGKGSVQSL
FT                   IPLGDGSTALKLTTAKYFTPLGKSIEGVGITPDVAINQTTLSQSDKAVIIKNQQAKSKQ
FT                   TQLASKVTDLQLAKAKQLLNLQ"
     atggacaaaa aaagcaccgt agcaaaatgg tttaaaaata caggctttac gcttaactta        60
     agcctgtatt tacttgccct atttgttttt attagctttt cagctaatgt gttttctagt       120
     tcgattaaag aattaaaaag ccaacaaata accgaaatcc tatttaatat tcatacctac       180
     tacgttgaag atcttgcact ccaaaacacc acacatacta gctataacaa ccaacaattt       240
     gcgcatttat atgcccagct cgatccctat tctaaatacc ttgatgaaca cgaattaaat       300
     gctttatttg ataatactaa tggccgctat accggtttag gcattgaggt taaacaaata       360
     aataataacg taaccattgt aaatgtagtg aataactcac ctgctaaaag tgctggggtt       420
     atggccggtg acattattat taacgttaat aatcaaacaa cacaacacag ctccgtagag       480
     catgttgctc agctaataac agcaagcaaa cttagtaata ttagtttaac cattaaacgt       540
     gataaccaac cgcaaccact taattttaat gtgagtcgcc gtaaaataaa gcttgaaagc       600
     gttactagtc agcgcttaga tttaggctgt ggttatttag ctatcaatag tttttctaac       660
     cacactttac atgaagtggc tttgcaaata gcagccatgc aaaatcactt tggggaccca       720
     cttaaaggcc tagttattga tttacgtgac aaccccggcg gtacacttag aagcgctgtt       780
     gcggtatcgg atctgttttt acaaaacggt actattgtta caaccaaagg gcgctataac       840
     gaggcaaata aagcttttta tgccaaacac ggagacattt taaaaggcgc ccctattgtc       900
     gtgctaatta acgaaaactc ggcatcagca gccgaaattt tagctgccgc attaaaagat       960
     aataaccgcg ccaaggttgt tggcagccaa tcttttggta aaggctcagt gcaatcgctt      1020
     attccacttg gtgatggcag cactgcatta aagctcacta cagctaagta cttcactcct      1080
     ttggggaaat caatcgaggg tgttggtatt acgcccgacg tggcgattaa tcaaacaacc      1140
     ctttcacaaa gtgataaagc cgttataatc aaaaaccagc aagctaaaag caaacaaaca      1200
     caactagcca gcaaggtaac tgatttacaa ttagctaaag ctaaacaatt acttaacctg      1260
     caataa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page