(data stored in ACNUC7421 zone)

EMBL: CR954246.PE349

CR954246.PE349       Location/Qualifiers
FT   CDS_pept        complement(381262..382404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0365"
FT                   /product="conserved protein of unknown function ; putative
FT                   protease"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12113939"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85463"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE5"
FT                   /protein_id="CAI85463.1"
FT                   /translation="MQKCINSVTKLILILTFLATATAVANEDRTKKDLSEVQTALKQSQ
FT                   SEYNAQRKKVATLQKNLQQHELDIAKNAKALNMAEQSIKKTEQQQQLQQQKADQLEQQH
FT                   AQFQHALAAQLKSAYMAGGDDDYAKMLLNQEDTAKFERTLSYYNYLNKARIEQLEELKA
FT                   LQLQIAQNQAELAKTKQKLVNLHDEQKRRQTALVNAQSERQANLKNLQAQLNSTKSSIN
FT                   YLKENQQTLITTIEELEKEKNKKVELLGLNNSKGKLNWPSRGKLEHTFGQRKHGGIDWK
FT                   GVLIGAKEGSNINSVHNGQVVFADWLKGYGWVIVVDHGEGFMSLYGHAQTLLKDVGDMV
FT                   REGETVALVGQSGGQASSGLYFEMRHKGRAVNPEKWCKRI"
     atgcaaaaat gtattaatag cgttactaag ctaattttaa tactgacttt tttagcgact        60
     gcaactgcag tcgctaatga agatcgtacc aaaaaagatc tcagcgaagt acaaacggca       120
     cttaagcaaa gccaatctga atacaacgcg caacgcaaaa aagttgccac gctacaaaaa       180
     aacctacaac agcacgaact cgacatagct aaaaacgcca aagccctaaa tatggctgag       240
     cagtcgatta aaaaaaccga acaacagcaa caactgcaac agcaaaaagc cgatcaactc       300
     gaacaacaac atgcacagtt tcaacacgca ttagctgcgc aacttaaaag tgcttatatg       360
     gccggtggcg acgatgacta tgcaaaaatg ctgctcaacc aagaagacac ggctaaattt       420
     gagcgcaccc taagctatta taattattta aataaagccc gtattgaaca actcgaagag       480
     ctaaaagcgc tgcagttaca aatagcgcaa aaccaggctg aactggctaa aacaaagcaa       540
     aaactagtaa acctgcatga tgaacaaaaa agacgccaaa ctgcattagt taacgcccaa       600
     agtgaacgcc aagccaattt aaaaaattta caggcacagc taaacagcac taaaagctca       660
     attaactatt taaaagaaaa ccaacaaacg ctgatcacaa ctattgaaga gctagagaaa       720
     gaaaaaaata aaaaagttga attactcggc ctcaataata gcaaaggcaa acttaactgg       780
     ccaagccgag gtaagttaga gcacactttt ggacaacgaa aacacggtgg tattgactgg       840
     aaaggcgtat taattggcgc aaaagaaggc agcaatatta acagtgttca taacggccaa       900
     gtggtatttg ccgattggtt aaaaggctac ggctgggtaa ttgtagttga ccatggtgag       960
     ggctttatga gcctttacgg ccatgcacaa accttattga aagatgttgg cgacatggta      1020
     agagaaggcg aaacggtagc gctagttggc caaagcggcg ggcaagcaag ttctggtcta      1080
     tactttgaaa tgcgccataa agggcgtgca gtaaatcctg aaaaatggtg caaacgcatt      1140
     tag                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page