(data stored in ACNUC7421 zone)

EMBL: CR954246.PE35

CR954246.PE35        Location/Qualifiers
FT   CDS_pept        41950..42849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0039"
FT                   /product="conserved protein of unknown function , putative
FT                   integral inner membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85149"
FT                   /db_xref="GOA:Q3IJ45"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ45"
FT                   /protein_id="CAI85149.1"
FT                   /translation="MYEFNGITMWSLQALAIDFAIIVLLFVSLKYIKGWVSNLHANDEI
FT                   TERDNFAFGISFAAGLVALAIVLTGVSSGAFAVSLQQEALQMLGYGALAILLIKLGHFF
FT                   QDKVALRKVSLHSEIVKGNVTAAVIDFGHVVSVAIVIRSALLWVATDGWHGLPIVVAAF
FT                   VIGSLVLLLVSQYRVQLFKRTNKSGDCLQQAIIDGNLAVGIRYAGFLIGSALAITAATG
FT                   IAPYVADNINASLLYWAISAVVSLLVFIILHLVTIKIILSGCDISDEVNRQKNVGVAAI
FT                   SAALSFAVGITMATLLGA"
     atgtatgaat ttaatggaat aacaatgtgg tcactacaag cgctggcgat tgattttgca        60
     attattgttt tgctgtttgt gagtcttaaa tatattaagg gttgggtatc taacctgcat       120
     gctaatgatg aaattactga gcgtgataac tttgcatttg gtattagttt tgctgcgggt       180
     ttagttgcat tggcgattgt gcttacaggt gtaagcagcg gtgcttttgc agtgtcatta       240
     cagcaagaag ctctgcaaat gttgggctat ggtgcactgg ctattttact tattaagctt       300
     gggcatttct ttcaagataa agttgcgctg cgtaaagtga gcttacatag cgaaatagtt       360
     aaaggtaacg tgactgcggc tgttatcgac tttggccacg ttgttagtgt cgccattgta       420
     attcgctcgg cattgctgtg ggtggctacc gacggttggc atggtttacc aattgtggtt       480
     gctgcttttg ttattggcag cctagtgctg ttgttagtga gccaatatcg cgtacagctg       540
     tttaagcgca ccaataaaag tggtgattgc ttacaacaag caattattga tggcaactta       600
     gccgtgggta ttcgttatgc cggtttttta attggcagcg cattagccat taccgcagca       660
     acggggattg cgccttatgt agccgataat attaatgcga gtttgttgta ctgggctata       720
     agtgcagtag ttagtttact ggtatttatt attttgcact tagtgacaat taaaataatt       780
     ttatctggct gtgatatttc agatgaagtg aaccgtcaaa aaaatgtggg tgtagccgct       840
     atttctgcag cgttatcatt tgcggtaggt ataactatgg caacactatt aggcgcataa       900
//

If you have problems or comments...

PBIL Back to PBIL home page