(data stored in ACNUC7421 zone)

EMBL: CR954246.PE351

CR954246.PE351       Location/Qualifiers
FT   CDS_pept        384581..385012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0367"
FT                   /product="conserved protein of unknown function ; putative
FT                   rhodanese sulfur transferase domain"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="2.8.1.1"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85465"
FT                   /db_xref="GOA:Q3IIE3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE3"
FT                   /protein_id="CAI85465.1"
FT                   /translation="MDQYIEFITNHPILSAAWVGIVFLIVSGWIKSKLSAVRQINPQQL
FT                   TLLINREDGQVIDMRAQKEFNTGHIAGAQHLSPENAKKSDFSNLEKYKSKPIILVCTTG
FT                   MTASGTATAMHKAGFEQVSVLSGGMGAWQSASLPTTTGR"
     atggatcaat atattgaatt tatcaccaat cacccaattt taagtgcagc ttgggtgggt        60
     attgtgtttc ttattgttag tggttggatc aaaagtaaac tctcagcagt gcgccaaata       120
     aacccgcagc agttaacgct gcttatcaac cgtgaagacg gtcaagttat tgatatgcgt       180
     gcgcaaaaag agtttaacac cggacatatt gccggtgctc agcatttaag ccctgaaaat       240
     gcgaaaaaat ctgacttttc aaaccttgaa aagtataaga gtaaacccat tatattggta       300
     tgtactacag gcatgaccgc ttcaggaact gcaaccgcta tgcataaagc gggttttgag       360
     caggtaagtg tgttatctgg tggtatgggc gcgtggcaat ctgcgagctt accaactaca       420
     accggtcgct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page