(data stored in ACNUC7421 zone)

EMBL: CR954246.PE352

CR954246.PE352       Location/Qualifiers
FT   CDS_pept        385042..385311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0368"
FT                   /product="glutaredoxin 3 GrxC"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="3.3.8 : Protein repair"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11741965; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85466"
FT                   /db_xref="GOA:Q3IIE2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE2"
FT                   /protein_id="CAI85466.1"
FT                   /translation="MSNVVLYTKAYCPFCQRARALLDSKGVQYTNFDIGVQPELRDEMI
FT                   AKAGGASTVPQIFINDEHIGGCDDMMAIEAQGQLDKKLNATLNA"
     atgagtaatg ttgttttata caccaaagcg tattgccctt tttgtcaacg tgctcgtgca        60
     cttttagaca gtaaaggtgt gcaatacaca aactttgata ttggtgtaca gcctgagctg       120
     cgcgatgaaa tgatcgccaa agcaggcggc gcaagcacgg taccgcaaat ctttattaat       180
     gatgagcata taggtggctg cgacgacatg atggcaatag aagcacaagg tcaacttgat       240
     aaaaagctaa atgccacact aaacgcttaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page