(data stored in ACNUC7421 zone)

EMBL: CR954246.PE355

CR954246.PE355       Location/Qualifiers
FT   CDS_pept        complement(387032..387496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0371"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85469"
FT                   /db_xref="GOA:Q3IID9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID9"
FT                   /protein_id="CAI85469.1"
FT                   /translation="MLDIVLYQPEIPPNTGNIIRLCANTGYSLHLIEPLGFAWDDKRIK
FT                   RAGLDYHEFSHVQRHASFEAYLEACKPKKIYACTTKGSQFHHQAQYEAGDCLVFGPETR
FT                   GLPDELIQSLPNEQRVRIPMQANSRSMNLSNAVSVFVYESWRQLGFPGAK"
     atgctggata ttgttttata ccaacctgaa atcccaccga atacgggtaa tattattcgc        60
     ttatgtgcaa atacgggcta ttcgctacat ttaattgagc cacttggctt tgcatgggat       120
     gacaaacgaa taaaacgtgc cggccttgat tatcatgaat ttagccatgt acagcgccat       180
     gcttcgtttg aagcttacct agaagcatgc aagcctaaaa aaatatacgc ttgcaccact       240
     aaaggcagcc aatttcatca tcaggcacaa tacgaggccg gcgactgttt agtatttggc       300
     cctgaaacac gcggccttcc ggatgagtta attcaatcgc ttccaaatga gcaacgggta       360
     cgtattccaa tgcaagccaa tagccgcagt atgaatttat ctaacgcggt ttcggtgttt       420
     gtgtatgaat cgtggcgcca acttgggttt ccgggcgcaa agtaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page