(data stored in ACNUC7421 zone)

EMBL: CR954246.PE356

CR954246.PE356       Location/Qualifiers
FT   CDS_pept        387676..388524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0372"
FT                   /product="putative transport protein"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85470"
FT                   /db_xref="GOA:Q3IID8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID8"
FT                   /protein_id="CAI85470.1"
FT                   /translation="MIAAKTWAWLASGSASMLGSLTDSLMDITATAMSFLVLGYALRPA
FT                   DDDHRFGHGKAEALAGLGQAAFIAGSGCLLAFHSIERLFNPLELTHSLLGVWVSIFAIA
FT                   CTLVIVFVQNKVVKHTESIAIKADSVHYKGDLILNAAVLLAILLSYYGVLYADPIFAVG
FT                   VAGYLLYNSWDIARDSADHLMDKELPDEEKQRILDVSKSHIDVRGVHGVRTRQGGKVKF
FT                   IQLHLELDDHLSLIRAHNVADEVEAMITKEFESEVDILIHLDPLSSVELSDTEGAAVTE
FT                   A"
     atgattgcag ctaaaacctg ggcatggctt gcctcgggtt cagcgtcaat gctgggctca        60
     ttaaccgatt cactcatgga tattactgcc acagccatga gctttttagt attaggttat       120
     gcactgcgcc ccgccgatga cgaccaccgt tttggtcacg gtaaagccga agcgcttgct       180
     gggctagggc aggccgcatt tattgcaggt tcaggctgtt tgttagcatt tcatagtata       240
     gagcgcttgt ttaatccttt agagctcact cattcattgt taggtgtatg ggtaagtatt       300
     tttgccattg cctgtacgtt agtgattgta tttgtacaaa ataaagtagt taaacatacc       360
     gaatctattg caataaaggc cgactcagtt cattacaaag gcgatttaat tttaaatgct       420
     gcggtactac tggctatttt actctcgtat tatggtgtgt tgtacgccga ccctattttt       480
     gcagttggcg ttgccggtta cctactttat aacagctggg atatagcccg agatagcgca       540
     gatcacttaa tggacaaaga gctgccagac gaagaaaaac aacgtatttt agatgtatcg       600
     aaaagccata tcgatgtgcg cggtgtgcac ggcgttcgta ctcgtcaagg tgggaaagtt       660
     aagtttattc aactgcattt agagcttgat gatcacctaa gcttaattcg cgcgcacaac       720
     gtagccgatg aagtagaggc aatgatcact aaagagtttg agtcagaagt tgatattcta       780
     attcatctag atcctttgtc ttccgtggaa ctgagtgaca ctgagggagc cgcagtaact       840
     gaagcgtaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page