(data stored in ACNUC7421 zone)

EMBL: CR954246.PE357

CR954246.PE357       Location/Qualifiers
FT   CDS_pept        complement(389162..390094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0373"
FT                   /product="putative lysophospholipase L(2)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /EC_number="3.1.1.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 3908445; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85471"
FT                   /db_xref="GOA:Q3IID7"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID7"
FT                   /protein_id="CAI85471.1"
FT                   /translation="MFYSSENELVNNQPSINDFYNNTLVKAYLNTPAGQLFYAYAKPEH
FT                   AHTAIVISSGRIEGLDKYKELLWELYTNNFAVFIVDHQGQGRSYRQLANKHKGYVKCFT
FT                   DYRHDLHLFNQQIVDNHWQGKKILLGHSMGGAIAFDYLAHFENNFSGLFLSAPMFDIHT
FT                   KNTPKPLAKLIANAAVFFGFSQSYALGQNDYNPEEFALNSLTSSQVRYKNFRQTYQDPL
FT                   LQLGGVTYGWLQAAFTFIASVDKLSINIPLFIASAERDEVVDNAAQYKLANRHNQAIIK
FT                   SFAGAKHELLFERDEIRQPLLTSLYQFCE"
     atgttttaca gtagtgaaaa cgagcttgtt aataatcaac ccagtattaa tgatttttat        60
     aacaacaccc tagttaaagc ctatttaaat acccctgccg ggcagttatt ttacgcctat       120
     gcaaaacctg agcatgcgca taccgcgatt gttattagct cagggcgtat tgaagggctt       180
     gataaataca aagagctatt gtgggagctg tacactaata attttgccgt gtttattgtt       240
     gatcatcaag gccaaggtcg ctcttaccga cagttagcca ataagcataa aggctatgta       300
     aaatgcttta ctgattatcg ccacgacctg catttattta atcaacaaat tgttgataac       360
     cactggcaag gcaaaaaaat actgcttggc cactcaatgg gcggcgcaat tgcctttgac       420
     tatttagctc attttgaaaa taactttagt gggttgtttt tatcggcacc tatgtttgat       480
     attcacacta aaaacacccc aaaaccgttg gcaaaactaa ttgctaacgc agctgttttt       540
     ttcggttttt cacaaagtta tgccctaggg caaaacgatt acaacccaga agagtttgct       600
     ttaaactcat taactagcag ccaagtgcgt tataaaaact ttaggcaaac ttatcaagac       660
     ccactactgc aacttggtgg cgtaacctat ggttggctac aagccgcatt cacctttatt       720
     gcatcggttg ataagttaag cattaatatt ccgctgttta ttgccagcgc agagcgcgac       780
     gaagtagtag ataacgccgc gcaatataaa ttagcaaacc gacataacca ggcaataata       840
     aagagctttg ccggtgctaa gcacgaacta ttatttgagc gtgatgaaat acgccagcca       900
     ttgctaacaa gtttgtacca gttttgtgaa tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page