(data stored in ACNUC7421 zone)

EMBL: CR954246.PE358

CR954246.PE358       Location/Qualifiers
FT   CDS_pept        complement(390098..391489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0374"
FT                   /product="putative sensor histidine kinase protein"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="3.3.6 : Protein modifications"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 3058985; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85472"
FT                   /db_xref="GOA:Q3IID6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID6"
FT                   /protein_id="CAI85472.1"
FT                   /translation="MASFSWLKHPRHYLFFKIFTWFWLTIIGTGAALIFLSSVTTINSV
FT                   SYNPLHGPMEKNLAYTAKNIERSTIKHKRSLNDTLKHPRRTNGKLLYLNAEQLEDSLTN
FT                   KSIPADVDLSLLNFTKSMPPQVIYTEKYQAIGPIKIRVPEGDFYLYEIDIYNHTPLYLR
FT                   LKLMPGWIKISIAIIASLILSFLFSRNLIAPINSLKKAAIKLSAGDLTARAAISVNRKD
FT                   ELGILGRDFNRMADQLAQLISAQKRLLADISHELRSPLTRLKMATGLAQMQANEASQSY
FT                   LLRIEKEANQLDKMIADVLQVSRLEANSQALSLHKQSLQDIVDHVLNDATFEAKQHNKQ
FT                   LQVSGSAAVTLNCDEALIASALENLLRNAIKYAQHTISLTLKHGDAIYIEICDDGPGVP
FT                   NNQLSKLCEPFFRQSDARDRVSGGTGLGLAIAKNAIIAHGGSLVLSNKPQGGLCAMVTL
FT                   PIIKE"
     ttggcaagtt ttagctggct taaacatcct cgccactatt tgttttttaa aatctttact        60
     tggttttggt taactattat tggcacaggt gcggcactta tatttttaag tagtgttaca       120
     actattaact ctgttagtta taaccctttg catggcccaa tggaaaaaaa cttagcttat       180
     accgctaaaa acattgagcg ctctaccata aagcacaagc gttcgcttaa cgatacgcta       240
     aagcaccctc ggcgtactaa tggtaagctt ttgtatttaa atgcagagca gctagaagat       300
     tcgctaacaa ataaaagcat acccgccgat gttgatttaa gcctgcttaa ctttactaag       360
     agcatgccgc cgcaagttat ttataccgaa aaataccaag caattgggcc aataaaaatt       420
     agagtacctg aaggtgattt ttatttatat gaaatagata tttacaacca tacgccacta       480
     tatctgcggt taaagttaat gccgggttgg ataaaaatat caattgctat aattgcctca       540
     cttattttaa gttttttatt tagccgtaac ttaattgccc ctattaatag cttaaaaaaa       600
     gccgctataa aactctccgc gggggattta acagcgcgcg ccgcaatttc ggtaaatcgt       660
     aaagatgagc taggaatatt agggcgcgac tttaaccgta tggccgacca attagcgcaa       720
     ttaattagcg cacaaaagcg cttactggcc gatatatcgc acgagctacg ctcgccactt       780
     actcgtttaa aaatggcgac aggccttgcg caaatgcaag ctaacgaagc cagtcaatcg       840
     tatttacttc gcatagaaaa agaagccaac cagcttgata aaatgattgc cgatgtattg       900
     caagtgtcgc gcttagaggc aaatagccaa gcgttatcgc tacacaaaca gtcactgcaa       960
     gatattgttg atcatgtact taacgatgcc acctttgaag caaaacagca caacaagcaa      1020
     ctgcaagtaa gcggctcggc ggcggtaaca ctaaattgcg atgaagcgct aattgccagc      1080
     gcactggaaa acttactgcg caacgcgatt aaatatgcgc agcacactat tagccttacc      1140
     ctaaaacacg gtgatgccat ttatattgaa atatgtgatg atggcccagg tgtaccaaac      1200
     aaccagctta gtaagctatg tgagccgttt tttaggcagt cagatgcgcg tgaccgagtg      1260
     agtggtggca cgggtttagg cttagcgatt gccaaaaatg cgattattgc tcatggcggc      1320
     agcttggttt tatcaaataa accacaaggt ggcctgtgcg ccatggttac tttgccaata      1380
     ataaaagagt ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page