(data stored in ACNUC7421 zone)

EMBL: CR954246.PE36

CR954246.PE36        Location/Qualifiers
FT   CDS_pept        42854..44575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0040"
FT                   /product="putative spermine/spermidine synthase family
FT                   protein"
FT                   /function="2.2.2 : Polyamines biosynthesis"
FT                   /EC_number="2.5.1.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85150"
FT                   /db_xref="GOA:Q3IJ44"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ44"
FT                   /protein_id="CAI85150.1"
FT                   /translation="MSSTIKSPSKFSLLGHDILLITVMAVLAGCGLIYEYLLSHYAGRV
FT                   LGSVESAIYAMIGTMIVAMGIGAFLARWFKDAFTAFAWLESIIALIGMGCILAIAGVIA
FT                   VSYSLPHMFSSIFNLPPDVVLNGYVFQKLQEWSRFLPYVFGLILGLFIGMEIPLIARIR
FT                   QHVYGRFLENNAGTIYGADYIGAGIGAAIWVSIMLSMPIMQAAAWTALFNIIAGLAFLW
FT                   RYHTYVRFAKLLLACHLLLLVLFAFILVLGSSWMDNLSNVLYKDKVIYSQATKYQHVVL
FT                   TERLSKNQPQPITDLYLNGRLQFSSVDEQIYHSMLVYPAMLASNRHERVLIIGGGDGLA
FT                   LRDVLKWPVSKVTLIDLDGQLLNLFGHKDAEFTSPEDISQRLLSLNSKSMHDPRADIIV
FT                   GDAFLEVEKLLDQAKQFDTILIDLPDPNHPDLNKMYSDYFYNHVRQLLAPDGAMAVQST
FT                   SPYHAKKAFLSIAKTVKAAGFEYVEQYQQNIPSFGQWGWTIATKMGQSASGRINDVTAM
FT                   PIPSRWISKEYLLASFIFPNNYFEHIKDIEVNRLGSGQLYDYYRTAWQIESELYKN"
     gtgtcatcaa ctataaaaag cccaagtaaa tttagtttac ttgggcacga tattttactt        60
     attactgtta tggccgtact cgcagggtgt ggccttattt atgaatactt actgtctcat       120
     tatgcggggc gggtacttgg ctcagtagaa agcgctattt atgcgatgat cggcactatg       180
     atagtagcaa tgggcattgg cgcattttta gcacgttggt ttaaagatgc atttaccgcc       240
     tttgcttggc tagaaagtat aattgctttg attggtatgg gctgtatttt agccattgcc       300
     ggcgttattg ctgttagcta ttcactgccg catatgtttt cgagtatttt taatttacct       360
     cccgacgtag tactcaatgg ctatgtattt caaaagctac aagagtggtc gcgtttttta       420
     ccctatgtat ttggccttat acttggcttg tttattggta tggaaatacc gcttattgcg       480
     cgtattcgtc agcatgttta tggccgtttt ttagaaaata acgcaggaac aatttatggt       540
     gccgactata taggcgccgg aattggcgcg gctatttggg ttagcattat gttgtctatg       600
     cccataatgc aagcagccgc gtggactgcg ctgtttaata taattgctgg gcttgctttt       660
     ttatggcggt atcacaccta tgtacgcttt gctaaactgt tattagcgtg tcacctgttg       720
     ttactagtat tatttgcgtt tatattggta ttgggcagta gttggatgga taacttgagc       780
     aatgttttat acaaagacaa ggttatttat tctcaagcca ctaaatatca acatgtggta       840
     ctaaccgagc ggttaagtaa aaatcagccg cagccaataa ccgatttata cttaaatggg       900
     cgcttacagt tttctagtgt tgatgagcaa atatatcatt caatgttagt ttacccggca       960
     atgttggcgt caaaccgtca tgagcgggta ctgatcattg gcggtggcga tgggctggca      1020
     cttagagatg ttttaaagtg gccggtgagc aaagtaaccc tgattgacct tgatgggcaa      1080
     ttgcttaatt tgtttggcca taaagatgct gaatttactt cgcctgaaga tattagccag      1140
     cggttgttaa gccttaatag caaatctatg catgatccgc gtgcagatat tattgttggt      1200
     gatgcctttt tagaagttga aaagttgctc gatcaggcaa agcaatttga tactatttta      1260
     attgatttac ctgaccctaa tcatcccgat ttaaataaaa tgtatagtga ctacttttat      1320
     aatcatgtac gccaattact agcaccagat ggcgcaatgg cggtgcagtc aacttcgcct      1380
     tatcatgcta aaaaagcctt tttaagtatt gctaaaacgg ttaaagcggc tggatttgaa      1440
     tatgtagagc agtatcaaca aaacattcct tcatttggac agtggggctg gactatagct      1500
     accaaaatgg ggcaatcggc tagtgggcga atcaacgatg taaccgcaat gccgatacca      1560
     tcaaggtgga tcagtaaaga atatttactg gctagtttta tttttccgaa taattatttc      1620
     gaacatatta aagatattga agtcaatagg ttaggctctg gccaactgta cgattattac      1680
     cgtacagcat ggcaaataga aagcgagttg tataaaaact aa                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page