(data stored in ACNUC7421 zone)

EMBL: CR954246.PE360

CR954246.PE360       Location/Qualifiers
FT   CDS_pept        392345..392830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0376"
FT                   /product="conserved protein of unknown function ; putative
FT                   CpxP (P pilus assembly/Cpx signaling pathway, periplasmic
FT                   inhibitor/zinc-resistance associated) domain"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85474"
FT                   /db_xref="GOA:Q3IID4"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID4"
FT                   /protein_id="CAI85474.1"
FT                   /translation="MTKVNTLSKLVLICGLATATFGATSVMAKGDMHKQGRHSQAHFLL
FT                   SERGADKLDLTQEQQTKLEAIFAAQKTQMQALKGTDKESRKAQRTAHKAKMESLLSAAT
FT                   FDENAAKELLAQRHEKGEEMGLIKLKTQHQVWQVLNAEQQEKFAKMQKRMGKKKHSK"
     atgactaaag taaatacact ttcaaaacta gtacttattt gtggcttagc aaccgctact        60
     ttcggtgcaa ccagtgttat ggccaaaggc gatatgcata agcaaggtcg ccactcacaa       120
     gcgcactttt tactatcgga gcgcggcgct gataaactcg atttaacaca agagcagcaa       180
     actaaattag aagctatatt tgcagcacaa aaaacgcaaa tgcaagcact taaaggcacc       240
     gacaaagaat cgcgcaaagc acagcgtacc gctcacaaag ctaaaatgga aagcttgtta       300
     tcagctgcaa cgtttgacga aaatgcagca aaagagctac tagctcaacg ccacgaaaaa       360
     ggtgaagaaa tgggtttaat taaattaaaa actcagcacc aagtgtggca agttctaaat       420
     gcagagcagc aagaaaagtt tgcaaaaatg caaaagcgca tgggtaagaa aaagcattca       480
     aaatag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page