(data stored in ACNUC7421 zone)

EMBL: CR954246.PE366

CR954246.PE366       Location/Qualifiers
FT   CDS_pept        398078..398689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0382"
FT                   /product="putative orphan protein ; putative membrane
FT                   protein, putative fimbrial assembly protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85480"
FT                   /db_xref="GOA:Q3IIC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC8"
FT                   /protein_id="CAI85480.1"
FT                   /translation="MLKQKFKQKLQWSIIHLLTGALVLTIAAMLIYLNWFYDGRYLLTD
FT                   LVGLAVIIFTLDLILGPVLSFWLLSPNKTKKENVINILLIVLLQVVSFSYGVVQIDSQR
FT                   LAYIIKWQSSYFAVSKSESRRDEITEHFYNFNEPKVGTVNRSQYDKLIKESISPVEMYE
FT                   FFEEVSFATECGLQCAVITKKGIVNVTKNSNSLVFNKSLR"
     atgttaaaac aaaaatttaa acagaaactc cagtggtcaa ttatacattt acttacaggg        60
     gctctggttt taactattgc tgcaatgctt atttatttaa attggtttta tgatggtcgt       120
     tatttgctaa cagatttagt tggcttagcg gtaattatat ttaccttaga tcttatttta       180
     ggcccagtac tgagtttttg gctactctca ccaaataaaa caaagaaaga aaatgtcatc       240
     aatattttat taatcgtatt actgcaagtt gtatccttta gttatggtgt tgttcaaata       300
     gacagtcaaa ggcttgctta tattataaaa tggcagagtt cttattttgc tgtatcaaaa       360
     agtgagtcta ggcgagatga aatcacggag cacttttaca attttaatga gcctaaagta       420
     ggcacagtta atagaagtca gtacgataaa ctaattaaag agtcgatttc gccagtagaa       480
     atgtatgagt tttttgagga agtaagtttc gcaactgagt gcgggctaca gtgcgcagta       540
     ataacaaaaa aaggtatagt aaatgttaca aagaatagta acagcctggt ttttaacaag       600
     tcccttcgtt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page