(data stored in ACNUC7421 zone)

EMBL: CR954246.PE367

CR954246.PE367       Location/Qualifiers
FT   CDS_pept        complement(398670..399065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0383"
FT                   /product="putative Pilus biogenesis protein tapA precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85481"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC7"
FT                   /protein_id="CAI85481.1"
FT                   /translation="MITIAIMGILISLALPAYNNHYKRAKFTEVVLATNALQRNIEICF
FT                   YIKESLNNCNTFSKLGSNKSDFLAPEFISDIEITNTALSIQIKSTASNKASISSAGDTY
FT                   IMLATINVNQLQWELLATSTCINEGTC"
     atgataacta tcgctattat gggaatatta atatcattag ctctgcctgc ttataacaac        60
     cattataagc gcgctaaatt taccgaagtc gttttagcaa ccaacgcatt acaacgtaat       120
     attgaaattt gcttttatat aaaagaatcc ttaaataatt gcaatacctt tagtaaacta       180
     ggtagtaata aatcagactt tttagcccct gagtttatct ccgacattga aattactaac       240
     accgccctaa gcatacaaat aaaatcaaca gcaagtaata aagcatctat ttctagcgca       300
     ggagatactt atattatgct tgcaacaata aatgtgaacc aactgcaatg ggaactattg       360
     gcaactagca cctgcattaa cgaagggact tgttaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page