(data stored in ACNUC7421 zone)

EMBL: CR954246.PE37

CR954246.PE37        Location/Qualifiers
FT   CDS_pept        44655..45068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0041"
FT                   /product="conserved protein of unknown function; similar to
FT                   E. coli YjfI"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85151"
FT                   /db_xref="InterPro:IPR019231"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF17"
FT                   /protein_id="CAI85151.1"
FT                   /translation="MELNELSIKLASFETEGANFESFLIANPGEQDVLQVIVDENDELP
FT                   IFVTQTQEQLLCISYLFDEDEVKPELRNELNETLLRLNVPIPLSAFAKIDNKYAIFGAL
FT                   SVNSSLDDITHELVTLADNAIDALEAVTMYLND"
     atggaattaa atgaactttc aataaaatta gcttcttttg aaacagaagg cgctaacttt        60
     gagtctttct tgattgctaa tccaggtgag caagatgtat tacaagtcat tgttgatgaa       120
     aatgatgagc ttccaatttt tgttacgcaa acacaagagc agttattatg cattagctac       180
     ttgtttgacg aagatgaagt taagccggaa ttacgtaacg agttaaacga aacattacta       240
     cgtttaaacg tgccaattcc attaagtgca tttgctaaaa tcgataataa atacgcgatt       300
     tttggcgcac tgtcggtaaa ttcatcatta gatgacatta cccacgaact agtgacatta       360
     gccgataatg ctattgatgc actagaagcc gtgaccatgt atttaaacga ttag             414
//

If you have problems or comments...

PBIL Back to PBIL home page