(data stored in ACNUC7421 zone)

EMBL: CR954246.PE373

CR954246.PE373       Location/Qualifiers
FT   CDS_pept        402058..402909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0389"
FT                   /product="putative ampicillin resistance protein"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85487"
FT                   /db_xref="GOA:Q3III0"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III0"
FT                   /protein_id="CAI85487.1"
FT                   /translation="MILVSIIIALILERLGARSAHWQISYYADGYVNRSANLLTNKGVF
FT                   GSGVGFLVWLLLPVLAIGCLYLLSDFVLWQLIFNVTILLVCFGCAKQRALYKSYLNALT
FT                   RDDKTAATLYALQMGQNRTEEEQDGETVGQTLAWVNFRFYCAVIFWFVILGVAGAVLYA
FT                   LVRTFADLVTQDDDEIIAKHSKMLHRLLFWLDWLPARITSFGYLVIGNFNKGTSCWLRY
FT                   ALDFSSPNRKVVTYTALAAEQVEKRYYDCAYEATCMIKLVKRNVLFYLVLIALLTLFGG
FT                   LD"
     atgattttgg tttcgataat aattgcatta atacttgagc gcttaggtgc tcgttcagcc        60
     cattggcaaa ttagctacta cgcagacggt tatgtaaatc gctcggcaaa cctgctcact       120
     aataaaggcg tatttggctc gggtgttggc tttttagtgt ggctactttt acctgtactg       180
     gctattggtt gtttatattt gctgtctgac tttgtgctgt ggcaacttat ttttaatgta       240
     acaatattac tcgtgtgttt tggctgtgct aagcagcgtg cattatataa gtcgtactta       300
     aacgctttaa cccgagatga taaaactgcg gctaccttat atgcactgca aatgggccaa       360
     aatcgcacag aagaagagca agacggcgaa acagttggac aaaccctggc atgggttaac       420
     tttagatttt actgcgcggt gattttttgg tttgtaatat taggcgtagc cggtgcggtt       480
     ttatatgcac tagtacgcac attcgcagat ttagtaacgc aagatgacga cgaaataata       540
     gcaaagcatt ctaaaatgct acacagatta ttattttggc ttgattggtt accagcgcgt       600
     attaccagct ttggttattt agtaataggt aactttaata aaggcactag ttgctggtta       660
     cgctacgcgc ttgatttttc aagccctaac cgcaaagtgg ttacttacac cgccttagct       720
     gcagagcaag tagaaaaacg ctactacgac tgcgcgtacg aagccacttg tatgattaaa       780
     ttggtaaaac gtaatgtatt gttttattta gtactgattg cgttattaac cctgtttggt       840
     gggctggatt aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page