(data stored in ACNUC7421 zone)

EMBL: CR954246.PE378

CR954246.PE378       Location/Qualifiers
FT   CDS_pept        411183..411779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0394"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85492"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH5"
FT                   /protein_id="CAI85492.1"
FT                   /translation="MTRCQQCLLAELYCICEGVVQADCDAAVCLLMYHNESFKPSNTGR
FT                   LIAEIVPENYAFRWDRTDPDAKLLALINDPQYQPMVVFPAEDVEPGRAVTEVNITAGKK
FT                   PLFIFLDGTWREAKKMIRKSPYLDNLPVLSITADKLSDYRLRVAPHAHQLGTAEVAIMV
FT                   LALAGEKDAATKLEQHFIKFRDAYLLGKRNKGRPE"
     atgacacgtt gccagcaatg cctacttgca gagctttact gtatttgtga aggggttgta        60
     caagccgatt gcgacgccgc tgtgtgttta cttatgtatc ataatgaaag ctttaaacct       120
     tcaaatactg ggcgtttaat tgccgaaata gtacctgaaa actatgcatt tagatgggat       180
     agaaccgatc ccgatgccaa acttttagca ttaataaacg atccgcaata tcaacctatg       240
     gttgtatttc ctgctgaaga tgtggagccg ggcagagccg taactgaagt aaatataaca       300
     gccggtaaaa aaccgctatt tatattttta gacggcacct ggcgcgaagc taaaaaaatg       360
     atccgcaaaa gtccgtattt agataacctt ccggtattgt cgatcactgc cgacaaactc       420
     tcagactacc gccttcgcgt tgctccccat gcgcatcaac ttggcaccgc agaagtggct       480
     attatggtgc tagcgttagc gggagagaaa gatgcagcca caaaactaga acagcacttt       540
     ataaaattcc gcgacgcgta cttattaggt aaacgcaata aaggcaggcc agagtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page