(data stored in ACNUC7421 zone)

EMBL: CR954246.PE379

CR954246.PE379       Location/Qualifiers
FT   CDS_pept        412176..413717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0395"
FT                   /product="putative aerotaxis sensory transducer"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12511500; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85493"
FT                   /db_xref="GOA:Q3IIH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH4"
FT                   /protein_id="CAI85493.1"
FT                   /translation="MSQQKQAIVDQEVTFGIDEELLSTTDLQGVITYANDNFCKVAGYT
FT                   LDELVGNNHSMVRHPDMPKAAFADLWSNLKNDIAWRGAIKNRCKNGQYYWVDAFVTPIY
FT                   ENGKKIGYQSVRRRLLPEYLNSAENLYKRINSGKSINTFTHKLSALKLPLYLCFSALFA
FT                   WLASYSLWFILLFIPLPFVIYYDQLVLSQRYLKKRKTESDSISRHVFSGSNIFSFADFQ
FT                   IKLLEGKVTTIVGRIIDGTLSLEKGANSLKAVAQKSKLGVEKEAAELHQVSSAVEQMVN
FT                   SIDEVAKSTVITTQKVNQAHSNCEAATQAMSQTMDKVSLLANEVDNSANSATELAKEAG
FT                   KIGDIMQEIQGIADQTNLLALNAAIEAARAGEHGRGFSVVADEVRALSSRTHSATEQIQ
FT                   TSIAEMQSTLLSWSKTMEVGKNAAEDCVKETRQTQEIVSQVHLSISDISDLTGQISTAA
FT                   EEQSMVSQEISRNIYNISETSSENLTQAQLVEVESDSIDKRSKMLASLGLSFKVD"
     atgagtcagc aaaaacaagc gatagtcgac caggaagtta cttttggtat tgatgaagaa        60
     ctactctcta ctacagattt acaaggagtc ataacttacg caaatgataa cttttgtaaa       120
     gttgctgggt atacattaga tgagctagta ggtaataacc atagtatggt gcgccaccct       180
     gatatgccca aagctgcgtt tgccgattta tggtctaatt taaaaaatga tattgcttgg       240
     cgaggtgcaa ttaaaaacag atgtaaaaat ggtcaatact actgggttga cgcatttgta       300
     acgccaattt atgaaaatgg aaaaaaaata ggctatcaat ctgttaggcg ccgactatta       360
     cctgagtact taaacagcgc agaaaatctg tataagcgta ttaatagtgg caagtctata       420
     aatacattta ctcataagct atcggcactc aaactccctc tatatttatg ctttagtgca       480
     ctttttgctt ggttagctag ttattcactg tggtttattt tgctgtttat tcctctgcca       540
     tttgttattt attatgatca gctcgtttta tcacagcgat accttaaaaa aagaaaaact       600
     gagtcagaca gtatctctcg ccatgtgttt tcgggcagta atatatttag ttttgctgat       660
     tttcaaatta aattactcga aggaaaagtc actacaatag tagggcggat catcgatgga       720
     acattgagtt tagaaaaggg tgccaactct ctcaaagccg ttgctcaaaa atctaaattg       780
     ggagttgaaa aagaagctgc agagctacat caggtttcgt cagcggttga gcaaatggtt       840
     aactcaattg atgaagttgc caaaagtact gttataacta cccagaaagt aaatcaagcg       900
     cattcaaatt gtgaagcagc tacgcaggct atgtcgcaaa ctatggataa agtttcttta       960
     ctcgcaaatg aggtagataa ttcagctaat tcagcaacag aattagccaa agaggcaggt      1020
     aaaattggcg atatcatgca agaaattcaa ggtattgcag atcaaactaa tttacttgcg      1080
     ttaaacgcag ccatagaggc agcgcgtgct ggagagcatg gtagaggctt ctctgtcgtt      1140
     gcagatgaag ttcgcgcgct atcaagcaga acccactctg ccactgagca aatacaaaca      1200
     tctatagcag aaatgcagtc aacgttatta agctggtcta aaacgatgga agttggaaaa      1260
     aacgctgccg aagactgtgt taaagaaaca cgccaaacac aagagatagt ttctcaggtt      1320
     catctttcta ttagcgatat atcagatctc acgggccaaa tatctacagc tgccgaagaa      1380
     caaagcatgg tatcgcaaga gattagccgt aacatttaca atattagtga aacctcaagc      1440
     gaaaacctaa ctcaagcaca attagtagaa gtcgaatcag attctattga taaacgctca      1500
     aaaatgcttg catcattagg gctatctttc aaagtagatt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page