(data stored in ACNUC7421 zone)

EMBL: CR954246.PE38

CR954246.PE38        Location/Qualifiers
FT   CDS_pept        45093..45785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0042"
FT                   /product="conserved protein of unknown function; similar to
FT                   E. coli YjfJ; could be a phage protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85152"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF16"
FT                   /protein_id="CAI85152.1"
FT                   /translation="MSILKKLFTAVRGGAREAGEAIVDKNGIRIFEQEIADAQNALHRA
FT                   KKSLTEVMAKEMQTKRKISAVDASIAEHEAYAGQALEKGNEALALEIAEKIGEFEAEKA
FT                   ENEQVLSGFSNHIVALKQQVKEAEKSIKENQRQLTMVKTTESVQQATMAVNSTLNTNSS
FT                   SMTSARQSLERIKQRQQDRQDQLGAAKELEADVNGDDLKAKMAEAGIGDSSPKSADILA
FT                   RIKAKQNS"
     atgagtattt taaaaaaatt atttacagca gtacgtggcg gcgcgcgtga agcaggcgaa        60
     gcaattgtag ataaaaacgg tatccgtatt tttgagcaag aaattgcaga tgcacaaaat       120
     gctttgcacc gtgctaaaaa aagcctaaca gaagttatgg cgaaagaaat gcaaactaag       180
     cgtaaaatta gcgctgtaga tgcatctatt gctgagcatg aagcttatgc tgggcaagcg       240
     ctggaaaaag gcaacgaagc tttagcatta gaaattgcag aaaaaattgg cgagtttgaa       300
     gctgaaaaag cagagaacga acaagtatta tctggtttta gcaatcatat tgtagcgctt       360
     aaacagcaag ttaaagaagc tgaaaagtcg attaaagaaa accaacgcca gctaactatg       420
     gttaaaacca cagaaagcgt gcaacaagct actatggctg taaacagcac attaaacact       480
     aacagctcgt ctatgacatc ggctcgccaa tcgcttgagc gtattaagca acgccagcaa       540
     gaccgtcaag atcagttagg tgcagctaaa gagcttgaag ccgatgtaaa cggcgacgat       600
     ttaaaagcga aaatggcaga agccggaatt ggcgacagca gtccaaaaag tgctgatatt       660
     ttagcgcgta ttaaagccaa gcaaaatagc taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page