(data stored in ACNUC7421 zone)

EMBL: CR954246.PE381

CR954246.PE381       Location/Qualifiers
FT   CDS_pept        415431..416213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0397"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85495"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH2"
FT                   /protein_id="CAI85495.1"
FT                   /translation="MKLKLLSILVAATAATNAFADDAEQKTWEVTSELGAIITSGNTET
FT                   TTLKGGIKVLHHLERWNNEYKLDGIYKEDEVENDDGTKDKQRTNEKYAISAQGNYKLNE
FT                   KHSHLFIYGSHVSDYFGAYRSESVVSAGYGLRLLNEKTMWLNAEIGPGYKYFKYPDVST
FT                   EVDENGNSLAGEYEGEIIALGKLDYNWKISDNARFTQLVTVEYGDTNTKTRSETALLAK
FT                   INGSLQMKVAYNIINNSDVADDKESTDTETSLTLVYSF"
     atgaaactaa agcttttatc aattttagtt gcagcaacag cagcaactaa cgcatttgca        60
     gacgacgctg agcaaaaaac ctgggaagtt accagtgagc taggcgctat tattaccagc       120
     ggtaacaccg aaacgaccac acttaaaggt ggtattaagg tattgcatca tctagaacgt       180
     tggaataatg agtacaaact cgacggtatt tacaaagaag acgaagtaga aaacgacgat       240
     ggtacaaaag acaaacagcg tactaacgaa aaatacgcta tttctgcaca aggcaattac       300
     aaattaaatg aaaaacactc gcacctattc atttatggtt cacacgtttc agactatttt       360
     ggtgcctata gaagtgagtc ggtagtttct gctggttatg gtttacgttt attaaacgaa       420
     aaaaccatgt ggttaaatgc tgaaattggt cctggttata agtactttaa gtatccagat       480
     gtaagcacag aagttgacga aaatggtaat tcacttgctg gtgaatacga aggcgaaatt       540
     attgccttag gtaaattaga ttacaactgg aagatttctg ataacgctcg ttttacgcaa       600
     ttagtaacag tagagtatgg tgacaccaac accaaaacac gttcagaaac tgcactactc       660
     gctaaaataa atggctcatt acaaatgaag gttgcttaca atattattaa caactcagat       720
     gttgctgatg acaaagaaag caccgacaca gagacctcat taacattggt ttacagtttt       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page