(data stored in ACNUC7421 zone)

EMBL: CR954246.PE382

CR954246.PE382       Location/Qualifiers
FT   CDS_pept        416337..417320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0398"
FT                   /product="putative polysaccharide export family"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85496"
FT                   /db_xref="GOA:Q3IIH1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH1"
FT                   /protein_id="CAI85496.1"
FT                   /translation="MNVFKYFIAVFILACGFGALAFTPTNAQIEQFKKLPKSQQEALAK
FT                   QYGVDLSSIGNISQSNETAATEQSTVINQRAEERKEPLTDEERFQPEIEPVKPFGYELF
FT                   AGEPTTFMPNESAAVPDTYLIGRGDQLLINFYGKESDSFEVIVDREGRINIPDLSPVQV
FT                   AGLTFAEVKELIKVKVEQEIIGVKAFVSLGQLRSMRIMVLGEAYKPGSYSVSSLTTVSH
FT                   ALFVSGGVSDIASLRNIQVKRAGKVITNFDMYDLLINGDSSNDIILKPGDVVFIPTVGE
FT                   QVAVEGLVKRPAIFELLGMGGILTKNIPERMIFAGNPAKKLKEIVE"
     gtgaacgttt ttaaatattt tatagctgtt tttattttag cgtgcggttt tggtgcttta        60
     gcattcacac caactaatgc acaaatagag cagtttaaaa aattaccaaa atctcaacaa       120
     gaagccctag ctaagcaata tggtgtagac ctttcctcaa ttggtaatat aagtcaatca       180
     aatgaaacag ctgctacaga acaaagtaca gttataaatc agcgcgcaga agagcgcaaa       240
     gaacctctta ctgacgaaga aagatttcaa ccagagatag aaccagtaaa accatttggt       300
     tatgagctat ttgcgggtga gccaactaca ttcatgccaa atgaaagtgc tgcagtgccc       360
     gacacctact taatagggcg tggcgatcag ttacttatta acttttatgg taaagaaagc       420
     gatagctttg aagtaatagt cgaccgcgag ggtcgtatta acatacccga tttaagccct       480
     gtgcaggtag caggtttaac ctttgctgag gttaaagagt taattaaagt taaagtagag       540
     caagaaataa ttggcgttaa agcctttgtg tcacttgggc agctacgtag tatgcgcatt       600
     atggtattag gcgaagccta taaaccgggt agctatagtg tatcgtcgtt gactaccgta       660
     tctcatgcat tatttgtaag tggcggcgtg tcagatattg cttcactgcg taacattcaa       720
     gtaaagcgcg caggtaaggt aattactaac tttgatatgt atgacttact tataaatggc       780
     gatagcagta acgatataat cctaaaacct ggtgatgtag tatttattcc aactgttggt       840
     gagcaagtcg ctgttgaagg cttggttaaa cgccctgcta tttttgaact gttaggcatg       900
     ggggggattc ttactaaaaa cattcccgaa cgaatgatct ttgccggtaa tccagcaaaa       960
     aaattgaagg aaattgttga ataa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page