(data stored in ACNUC7421 zone)

EMBL: CR954246.PE384

CR954246.PE384       Location/Qualifiers
FT   CDS_pept        418169..419347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0400"
FT                   /product="putative aminotransferase, DegT/DnrJ/EryC1/StrS
FT                   family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85498"
FT                   /db_xref="GOA:Q3IIG9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG9"
FT                   /protein_id="CAI85498.1"
FT                   /translation="MLNTTFSPWPSFTQDEADAVSRVVLSNKVNYWTGTEGREFEKEFA
FT                   SWADSEYAIALGNGTLALDIALKALNVGSGDEVITTPRTFLASASSIVTAGAAPVFADV
FT                   DLNSQAITAASIKAVLTPKTKAVIVVHLAGMPAEMDSIMALSKEHGFYVIEDCAQAHGA
FT                   KYKGRSVGSIGHVGAWSFCQDKIMTTGGEGGIVTTNSKELWSIMWSYKDHGKSFDAIYN
FT                   REHPPGFRWLHESFGTNWRMTEMQAVLGRIQLTRMSDWTAKRQAYGAELDKAASEFDSI
FT                   RLVTVPSYIEHAEYKHYMFVKPEKLAEGWDRDRMVNEIVERGVPCFQGSCSEVYLEKAF
FT                   NNTPWRPDKRLPNAVELGETSLMFLVHPTLTEAEITKTTQVMKEVFSLASKS"
     atgttaaata ccacattctc tccttggccg agcttcactc aagacgaagc cgatgctgta        60
     agccgtgttg tgctttcaaa taaagttaat tactggacgg gcactgaagg ccgtgagttc       120
     gaaaaagaat ttgcctcatg ggccgatagt gaatacgcca tagctttagg taatggtacg       180
     ctagcgcttg atatagcatt aaaagcactt aatgtaggtt ctggtgatga agtgatcact       240
     acaccacgta catttttagc atctgcttca agcattgtca ccgctggtgc tgcacctgtt       300
     tttgcagatg tggatttaaa tagccaggca attacagctg ctagtattaa agcagtactt       360
     acaccaaaaa caaaagcggt gattgttgta catttagcag gtatgccagc agaaatggac       420
     tcaataatgg cattgagtaa agagcatggc ttttatgtaa ttgaagattg tgcccaagcg       480
     catggtgcaa aatataaagg ccgctcagtg ggtagtattg gccatgtggg cgcatggagc       540
     ttttgccaag ataaaataat gaccactggc ggtgagggcg gcatagtaac gactaactct       600
     aaagagttat ggtctattat gtggagctat aaagaccacg gtaaaagctt tgatgctatt       660
     tataaccgtg aacacccacc aggatttaga tggttacacg aaagctttgg taccaattgg       720
     cgtatgaccg aaatgcaagc tgtactcggt cgtattcaat taacgcgcat gagtgattgg       780
     actgctaaac gccaagccta tggtgctgag ctagataaag ctgccagtga atttgacagt       840
     attcgtttag taacagtacc aagttatatt gaacatgctg aatacaaaca ctatatgttt       900
     gttaagcctg aaaaactagc tgaaggctgg gatcgcgatc gtatggtgaa cgaaatagtt       960
     gaacgcggtg taccatgttt tcagggaagt tgctcagagg tttatctaga gaaggcattt      1020
     aataacaccc cgtggcgtcc tgataaacgt ttacccaatg cggtagagct aggtgaaact      1080
     tcacttatgt ttttagttca ccctacactc actgaagctg aaataactaa aacaactcag      1140
     gtaatgaaag aagtattctc gttggcgtct aaatcttaa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page