(data stored in ACNUC7421 zone)

EMBL: CR954246.PE385

CR954246.PE385       Location/Qualifiers
FT   CDS_pept        419833..421788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0401"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85499"
FT                   /db_xref="GOA:Q3IIG8"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG8"
FT                   /protein_id="CAI85499.1"
FT                   /translation="MDSFIRSIINAPRAKKRVITLFIDSLFIAAAFWLALIVRLDSLEP
FT                   LSVSGNWLLLALLIPISLYAFITLGLYRAVLRYMNSQAVWAIILGTLITTVSLVLLAFF
FT                   VGIEIPRTMPFIFAWLCLLTVGGSRIIVRALIGRMTTSNKDAVIIYGAGSSGRQLATAL
FT                   NAGPEYFVSAFIDDDVTKHGSIIQGIPVRAFNDIHALIKKRKATKVLLAMPSETRARRK
FT                   EVLAQLEPLTIKVLSIPGMADIVEGKAKLSEFRDVEIEDLLGRDPVTPKDDLMTVNITD
FT                   KVVMVTGAGGSIGSELCRQIIKLKPTKLVLFERSEIALYSIEKELGEYIISNTLNIELI
FT                   PIMGSVQRVNRLETVMRTFGVRTIYHAAAYKHVPLVEHNVVEGVRNNVFGTYYAAKAAV
FT                   EAKVDTFVLISTDKAVRPTNIMGATKRMAELVLQGLAQEQGAKHKTRFCMVRFGNVLGS
FT                   SGSVVPLFRRQIKEGGPITLTHPDITRYFMTIPEAAQLVIQAGAMGKGGDVFVLDMGDS
FT                   VKISDLATKMVRLSGLEIKTDDTPHGDIEIKCTGLRPGEKLYEELLIGDNVEQTSHERI
FT                   MTAKEVMLPLSELNVFIEALDIACHDFNHETIRQLLLDAPTGFNPTDGICDLVWNARLE
FT                   NKGNTESESNVVNLSK"
     atggatagct ttatccgctc aattattaat gccccacgtg ctaaaaagcg tgttatcacg        60
     ctttttattg actcactttt tatagcagcc gctttttggt tagcgttaat agtaaggctt       120
     gacagcttag agccattaag tgtttctggt aattggttat tattagcact cttaattccc       180
     attagtttat atgcatttat tactttaggt ttataccgcg ccgtattgag gtatatgaac       240
     tcacaagcag tatgggccat tatactcggt acgcttataa ctaccgtaag tttggtttta       300
     ttagcatttt ttgttggtat agagatacca cgtactatgc catttatttt tgcttggcta       360
     tgtttattaa ccgtcggtgg ctcacgtata atagttcgcg cacttatagg aagaatgacc       420
     accagcaaca aagatgcggt gattatttat ggtgcaggat cgtcggggcg gcaattagca       480
     acggctttaa atgcagggcc agagtatttt gtaagtgcgt ttattgatga cgatgtgaca       540
     aaacatggct ctataataca aggcataccg gtacgtgcgt ttaatgatat acatgcatta       600
     ataaaaaaac gtaaagcaac gaaagtgttg ctcgctatgc ccagtgaaac acgtgcaagg       660
     cgtaaagaag ttctcgcaca acttgagcca ttaaccatta aagtactttc tatccctggt       720
     atggctgaca tagtcgaagg taaagcaaaa ctttctgaat ttagagatgt tgaaattgaa       780
     gatttactag gacgcgaccc agtaacccct aaagatgatt taatgactgt taatataact       840
     gataaagtag tcatggttac tggcgctggt ggctcaatag gctctgagct gtgtagacaa       900
     ataattaaac tcaaaccgac taaattggtg ttgtttgagc gcagtgaaat cgccctttat       960
     tcaattgaaa aagaattagg tgaatacata attagcaata cgcttaatat tgaactcatc      1020
     cctatcatgg gctcagtaca acgtgtaaat cgccttgaaa cggtaatgag aactttcggt      1080
     gtgcgaacca tctaccacgc cgcggcttat aagcacgtac cattagttga gcacaatgta      1140
     gtagaaggtg tacgtaataa tgtatttggt acctattacg ctgcaaaggc cgccgttgag      1200
     gctaaggtag atacctttgt actcatttct accgataaag cagtacgccc gactaatatt      1260
     atgggcgcaa caaagcgtat ggctgagtta gtactgcaag gtttagcaca agagcaaggc      1320
     gctaaacaca aaacgcgttt ttgtatggtg cggtttggca atgtacttgg ttcaagtggc      1380
     tcagtagtac cattatttcg ccgccaaata aaagaaggtg ggccaataac attaactcac      1440
     cccgatatta cccgttactt tatgactata cctgaagcag cacagctcgt tatacaagca      1500
     ggcgctatgg gcaaaggcgg tgacgtgttt gtactcgata tgggtgactc ggtaaaaata      1560
     agtgatttgg caaccaaaat ggttaggtta tcgggcctcg aaattaaaac tgatgatacc      1620
     ccgcatggtg atatagaaat aaagtgtact ggcttacgcc caggtgaaaa actgtatgaa      1680
     gagctattaa taggcgataa cgtagagcaa acatcgcatg agcgtataat gacggcaaaa      1740
     gaagtaatgt tacctttgtc agagcttaat gtatttattg aagcgcttga tattgcatgc      1800
     catgacttta atcacgaaac tatacgtcag ttattacttg atgctcctac aggctttaac      1860
     ccaaccgacg gcatctgtga tttagtatgg aatgccagac ttgaaaataa aggtaatact      1920
     gaaagcgaaa gtaatgtggt taatttaagt aaatag                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page