(data stored in ACNUC7421 zone)

EMBL: CR954246.PE387

CR954246.PE387       Location/Qualifiers
FT   CDS_pept        422046..422237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0403"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG6"
FT                   /protein_id="CAI85501.1"
FT                   /translation="MYQSLSYVVNMVWVTQPFINGALNASLMTRMEELEDENRRLKKMY
FT                   AEERLKSEVIQEAMAKKW"
     gtgtaccaat ccctgagtta tgtcgtgaac atggtatggg taactcaacc ttttataaat        60
     ggcgcgctaa atgcgtcttt aatgacgcgc atggaagagc ttgaagatga aaaccgccgc       120
     ttaaagaaaa tgtatgctga agagcggctc aaatctgagg tcattcaaga ggccatggca       180
     aaaaagtggt aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page