(data stored in ACNUC7421 zone)

EMBL: CR954246.PE388

CR954246.PE388       Location/Qualifiers
FT   CDS_pept        422231..422512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0404"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85502"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF4"
FT                   /protein_id="CAI85502.1"
FT                   /translation="MVKASERKVLAHKVVSTNKMSIALACRTFMISETCYRYTPILRNE
FT                   NLKIAKLLLDLTELKRSWGFGLCFLYLRNEKSTSGITSEFTAFTVILS"
     gtggtaaagg cttctgagcg caaagtattg gcacataaag tcgttagcac aaataaaatg        60
     agtattgcct tagcttgccg tactttcatg ataagtgaaa cgtgttatcg ctatacaccg       120
     atattaagaa atgaaaatct aaaaatagca aagctgttac tcgatttgac tgagttaaag       180
     cgaagttggg gttttggatt atgtttttta tatttgcgta atgaaaaaag cacaagtgga       240
     atcacaagcg agtttaccgc atttaccgtg atcttgagtt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page