(data stored in ACNUC7421 zone)

EMBL: CR954246.PE389

CR954246.PE389       Location/Qualifiers
FT   CDS_pept        422515..423060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0405"
FT                   /product="putative orphan protein ; putative transposase
FT                   (partial)"
FT                   /function="6 : No similarity"
FT                   /EC_number="2.7.7.49"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85503"
FT                   /db_xref="GOA:Q3IIG5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG5"
FT                   /protein_id="CAI85503.1"
FT                   /translation="MRIKPRKRLNRDKPEPLAVPETINECWSMDFMHDQLADGRACRLF
FT                   NVIDDFNREGLTIDADLSLPAERVIRSLNQIIEWRGKPKAIRCDNGPEYISKQLAQWAL
FT                   NNDIELRFIQPGNPQQNAYIERFNRTVRYDWLSHYIYSDISELQDRATDWLWTYNNERP
FT                   NMGLGGITPIQKLEKLNN"
     ttgcggatca agccaaggaa acgcttaaat agagataagc ctgagccatt ggcagtacca        60
     gaaaccatca atgaatgttg gtcaatggat tttatgcatg atcaattagc ggatggcaga       120
     gcatgtcgat tgtttaatgt cattgatgac tttaatcgag aagggctgac tattgacgct       180
     gatttatcac tgcctgctga acgtgtgatc cgctcgttaa atcaaattat agagtggcgt       240
     ggtaaaccca aagctatcag atgtgataat gggcctgaat atattagcaa gcagctagcg       300
     caatgggcgt taaataatga tatcgaatta cggtttattc aacccggtaa cccgcagcaa       360
     aatgcctata tagagcgctt caaccgaacg gttcgttacg actggctgag tcattatatt       420
     tatagtgata ttagtgagtt acaagataga gcgactgatt ggctatggac ttataataat       480
     gaacgcccta acatgggcct aggtggtata acacccatac aaaagctgga aaaattaaac       540
     aactga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page