(data stored in ACNUC7421 zone)

EMBL: CR954246.PE39

CR954246.PE39        Location/Qualifiers
FT   CDS_pept        45860..46498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0043"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85153"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF15"
FT                   /protein_id="CAI85153.1"
FT                   /translation="MFNFFKSKKEPERQLNHASELKKGDMFTVIDSFAYPAWLKGQTLR
FT                   VIDIQTYQYQHSSDTEFVLESDSGQVVFLQIEQEDGEQWANFSIKVQRDEVEDIFGLDQ
FT                   FARIFDEESLTHITVQNIPERFTQFLANSYQQSESPFVCYFHNKDYRNQALPRYEQEGG
FT                   ELCEMICLESDDKGFGLNIEIWDGGETEVSLTLTRPITDIVDLFPGDAK"
     atgtttaatt ttttcaaatc taaaaaagag ccagagcgtc agcttaatca tgccagtgag        60
     cttaaaaaag gtgacatgtt tactgtcatc gattcatttg cttatccagc gtggttaaaa       120
     gggcaaactc ttcgcgttat tgatatacaa acttaccagt atcaacacag tagtgacact       180
     gagtttgtgt tggaaagtga cagcggccaa gtggtatttt tacaaataga gcaagaagat       240
     ggtgagcaat gggctaactt ttctataaaa gtacaacgtg atgaagtaga agatatattt       300
     ggccttgatc agtttgcgcg tatttttgat gaagagtctt taacgcatat cacagtgcaa       360
     aatataccag agcgttttac gcagttttta gctaacagct atcagcaaag cgaatcgcca       420
     tttgtgtgtt attttcataa taaagactat cgcaatcaag ctcttccacg ttatgagcaa       480
     gaaggtggtg agctgtgtga aatgatttgt ttagagtctg atgataaagg ctttggttta       540
     aatattgaga tttgggatgg tggcgaaacc gaagtatcgc ttaccttaac gcggccaatt       600
     accgacattg ttgacttgtt tccaggagac gctaagtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page