(data stored in ACNUC7421 zone)

EMBL: CR954246.PE390

CR954246.PE390       Location/Qualifiers
FT   CDS_pept        423413..424981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0406"
FT                   /product="putative orphan protein ; putative
FT                   acyltransferase"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85504"
FT                   /db_xref="GOA:Q3IIG4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG4"
FT                   /protein_id="CAI85504.1"
FT                   /translation="MIVNTPNESNQVVNQAIFGSTFISNIGFWLQNSYFSKAEFNPLLH
FT                   LWSLGVEIQFYLIVPILAWFFSKTRFSLVFIVIVSMALCFIVLTISPKTSFFMMPLRLW
FT                   EFLLGYGVALYLTQSGAVKFPKQSWLGFVGLILILLIPFFNVNGESLSIILGHPGAGAL
FT                   LVSIATSIVLVFGLPKIVEKNIISKGLAILGKYSYSIYLIHFPVIVLYLSEPFMGTILD
FT                   IPNVITFIIIFALIFTLSFTLHKLVETRNFNISITKLSVIFIALIIGLAIIGPWIKTNF
FT                   ISNQEKSIFNAFNDRSTYRCGKLIRITNPTTLTCNLSEDINDTVNKVMLVGNSHADSIK
FT                   TTFIKVAAKHNQAVYFIVQNNPLMAGGLSPDIVVREAISKEVKHIVVHFSPSGISVSKL
FT                   KELVFLAEKNSIKITFIDPVPVWESHIPKMMYRQLKGFNDNELQTKDDYLSFNNELFTE
FT                   VDNISNDNFKRISIADYFCTPNCSYKLEDGTPFYFDSGHLTLTGSNVIEKALNEAISAG
FT                   KYSEN"
     ttgattgtaa atacacccaa cgagagtaac caggtagtaa accaagcgat atttggttct        60
     acatttatat caaatattgg cttttggctt caaaattcat attttagtaa agctgagttt       120
     aatcctcttt tgcacctttg gtccttggga gtagaaattc agttctattt aattgttcct       180
     attctagcct ggtttttttc taaaactcgt ttttcccttg ttttcattgt tatagtatca       240
     atggctttat gttttattgt gttaacaatt tcaccgaaga catcgttttt tatgatgcca       300
     ttgagattgt gggagttttt attaggctac ggagttgctt tgtatctcac tcaaagtggg       360
     gccgttaagt ttcctaaaca gtcttggctg ggctttgttg gtttaatact aatattactt       420
     atacccttct ttaatgtaaa tggtgaatca ttaagtataa tattaggcca tcctggtgct       480
     ggagcgttat tggtatcaat agcaacttcg attgtattgg tatttggact acctaaaata       540
     gttgaaaaaa acataatatc aaaagggtta gcaatactag gtaagtattc ttattctata       600
     tatcttatac actttcctgt aatagtcctt tatctatcag aaccatttat ggggactatc       660
     ctcgatatac caaatgttat tacatttatc attatattcg cactaatatt tactttgtca       720
     tttactctcc ataaattggt tgagactcgt aactttaata tcagtatcac aaagttatct       780
     gttatattta tagctttgat tattggcctt gctataattg ggccgtggat aaaaactaat       840
     ttcatttcga accaagaaaa aagtatattt aacgccttta atgatcgttc gacatatcga       900
     tgcggaaagt taattcgaat tactaaccca acaactttaa catgtaattt gtctgaggat       960
     ataaatgata cagtgaataa agtaatgtta gttggtaata gccatgcgga ctctattaaa      1020
     acaactttta ttaaagttgc tgctaaacat aatcaagctg tttactttat tgtacaaaat      1080
     aaccccttaa tggctggagg tctctcacct gatatagttg tgagagaggc aatatctaag      1140
     gaggttaagc atatagtcgt tcacttttct ccttcaggca tttctgttag taagttgaaa      1200
     gagcttgttt ttttagcgga aaaaaatagt ataaaaataa catttataga ccccgttcca      1260
     gtttgggaat cacatattcc taaaatgatg taccgtcaat taaaaggctt taatgataat      1320
     gagttacaaa ctaaagatga ttacttatct tttaataatg agctttttac tgaagtagat      1380
     aatatttcaa acgataactt taaaagaata tcgatagcag attatttttg tactccaaac      1440
     tgctcttata aactagaaga tggcactcct ttttatttcg atagtggtca tttgacatta      1500
     acaggaagca atgtgattga aaaagcatta aatgaagcta taagtgcagg aaaatactca      1560
     gaaaattaa                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page