(data stored in ACNUC7421 zone)

EMBL: CR954246.PE391

CR954246.PE391       Location/Qualifiers
FT   CDS_pept        complement(425137..425622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0407"
FT                   /product="putative orphan protein ; putative insertion
FT                   sequence ATP-binding protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85505"
FT                   /db_xref="GOA:Q3IIG3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG3"
FT                   /protein_id="CAI85505.1"
FT                   /translation="MSDAICRTFTKHGGNILLFGASGLGKTHIASSIGYGLIEQGHKVK
FT                   FVAASAIVQQLQQAKRHLRLQDELVKLDKYSLLIVDDVGYVRKTEQETSVLFELIAHRY
FT                   ERHSMIITSNKSFEQWDELFEDSTMTVAAIDRLVHHATIIHCEGDSYRRKTALNKSK"
     ttgtcagacg caatttgccg gacgttcacg aagcacggtg gcaatatatt gctatttggc        60
     gccagtggtc ttggtaaaac gcatatcgcc agtagtatcg gttatggcct tatcgagcag       120
     ggccataaag ttaagtttgt tgccgcgtca gcgattgttc aacaactcca gcaagcaaag       180
     cgacatttac gcttgcaaga tgaacttgta aagctcgata aatacagctt attaatcgtt       240
     gatgacgttg gttacgttcg aaaaactgaa caggaaacga gcgtgctgtt tgaattgata       300
     gcccatcgct atgagcgaca cagcatgatc atcacatcaa acaaatcatt tgaacaatgg       360
     gatgaactat ttgaagattc aacaatgact gtcgcggcaa tcgatcgttt ggttcatcat       420
     gcaacgatta ttcattgcga aggtgacagt taccggcgca aaacagcgct caataagagc       480
     aaatga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page