(data stored in ACNUC7421 zone)

EMBL: CR954246.PE392

CR954246.PE392       Location/Qualifiers
FT   CDS_pept        425674..425973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0408"
FT                   /product="putative orphan protein ; putative transposase"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85506"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG2"
FT                   /protein_id="CAI85506.1"
FT                   /translation="MRIMRSPEQWRTIIHEQQSSGLTIIDYCRQHQLSMTSFYAVRKKL
FT                   GLSSNNFVRAKITQQVEIVDEQSSITLTVGKANVSLPATTSATYLSQLLREFVQ"
     atgagaatta tgcgcagccc agagcaatgg cgaaccatca tccatgaaca acaatcaagt        60
     ggtttaacca ttattgatta ttgccggcaa catcaattat caatgactag cttttatgcg       120
     gtaagaaaga aactcggcct atcatcgaat aatttcgttc gcgccaaaat tacacagcaa       180
     gtcgaaatag ttgatgaaca atcatccatc acgttaacag ttggcaaggc taacgtgagt       240
     ttgccagcca caacctccgc aacgtattta agccagttac tacgcgagtt tgttcaatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page