(data stored in ACNUC7421 zone)

EMBL: CR954246.PE393

CR954246.PE393       Location/Qualifiers
FT   CDS_pept        425970..426317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0409"
FT                   /product="putative orphan protein ; putative transposase
FT                   (IS66 family element,Orf2-like)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85507"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG1"
FT                   /protein_id="CAI85507.1"
FT                   /translation="MKMFVEPSEVFLHRDFVDFRKSINGLVSIVEDELVRDAYTGTLFV
FT                   FCNKAKDKLKILYWDKTGFALWYKRLEKQKFKWPSKLSSQEFELTYQQLSWLLSGYDVL
FT                   GHEPLHYQSPI"
     atgaaaatgt ttgttgagcc gtcagaggtt tttctgcatc gggattttgt cgactttcga        60
     aaaagtatta atggcttagt gagtattgtt gaagatgagc ttgttcgcga tgcctatacc       120
     ggtacgttgt ttgtattttg taacaaggcc aaagataagc tgaaaattct atactgggat       180
     aaaacagggt tcgcgctttg gtataaacga cttgaaaagc aaaaattcaa atggccaagt       240
     aaactatcga gccaggaatt tgaattaacc tatcaacaac tgagttggtt gttatctgga       300
     tatgacgtgc ttggccatga accgctgcac tatcaatcac cgatctaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page