(data stored in ACNUC7421 zone)

EMBL: CR954246.PE394

CR954246.PE394       Location/Qualifiers
FT   CDS_pept        426414..427976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0410"
FT                   /product="putative transposase (IS66)"
FT                   /function="4.5 : Transposons and ISs"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85508"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG0"
FT                   /protein_id="CAI85508.1"
FT                   /translation="MKIDTHSLPDDPEQLKQMLLELQAKTTQELAEKDKIISEQAIQIN
FT                   QFIERYEIAKRKQFGKSSEQLPGARETFNEAEEIIDEADKTLLAAADSHNKITIKNKPT
FT                   RKPLPKELPRKVVTIDVSIDEKMCDCCQGKLHKIGETRSEKLEFVPAYIKVIETVRPKY
FT                   ACKKCEQTGTENSIKVAPVPATPIPKGIATSSLQSQIISAKYQYGLPLYRQEKMFNEYG
FT                   IELSRKTMSDWIIRCSELLMPLVNELKAALLSQAVIHADETPLKVIKADNSSSYMWVYC
FT                   CGSDSVTANSLPNIILYDYHNSRAAACVVDYLGDYDGYLQVDGYAAYGKTDAILAGCMA
FT                   HARRKFIDAKTVQTKNKTGKADVALSLIRKLYGIEASLKDKTAAERYQARQESSKPIID
FT                   KLHHWIIENKDKVPPKSKLGEAITYWCNQEHKLITYLKDGRINIDNNRAERAVKPFVIG
FT                   RKNWLFSNTARGATASAVLYSIIETAKANGLLVDNYLQTCQDELAKKPESVEHLLPWNV
FT                   NQG"
     atgaaaattg atacacactc actccctgac gacccagaac aactcaagca aatgttgctt        60
     gagttgcagg ctaaaactac ccaagagtta gcggaaaaag ataaaatcat cagtgaacaa       120
     gccattcaaa ttaatcagtt tattgaacgc tatgaaattg ccaagcgtaa acagtttggt       180
     aaaagctccg agcaactccc gggggcgagg gaaaccttca atgaagcaga agaaatcatt       240
     gatgaggccg ataaaacgtt attagctgcg gctgatagtc acaataagat cacaattaaa       300
     aacaaaccga cgcgcaagcc actgccaaaa gaattacctc gaaaagtggt gacaattgat       360
     gtgtccattg atgaaaaaat gtgtgattgt tgccaaggta agctgcataa aattggtgaa       420
     actcgtagcg aaaaacttga gtttgttcct gcgtacatca aagtgataga gacagttcga       480
     ccgaaatatg cttgtaaaaa gtgtgagcaa actggcacag aaaattctat aaaagttgca       540
     cctgttccag caacacccat tcctaaaggc attgccacca gtagtttaca gagtcaaatc       600
     atcagcgcca aatatcaata tggattgccg ttatataggc aagaaaaaat gttcaatgag       660
     tatggtattg agctgagccg taaaaccatg tcagattgga taatacggtg tagtgaattg       720
     ctgatgccat tagttaacga gctaaaagca gcattgctta gtcaagcggt gatccatgcc       780
     gacgaaacgc ccttaaaggt gattaaggcc gataatagca gcagttacat gtgggtgtat       840
     tgttgtggta gcgattcggt gaccgccaat agtttgccaa atattatcct ctatgattat       900
     cacaactctc gtgccgcagc ttgtgtagtt gattaccttg gtgactatga cggttacctg       960
     caagtcgatg gttatgcagc atacggaaaa acagatgcaa tattggcagg ttgtatggcg      1020
     catgcacgtc gaaaattcat tgatgcgaaa acggtgcaaa cgaaaaacaa aaccggcaaa      1080
     gccgatgttg ccttaagtct tattagaaaa ctctacggca ttgaggcaag cttaaaagac      1140
     aaaacggccg cagaaagata tcaagcacgg caggaaagtt caaaacctat catcgataaa      1200
     cttcaccatt ggattatcga aaataaagat aaagtgccac cgaaaagtaa acttggtgaa      1260
     gcgattacgt attggtgtaa ccaagaacat aagctcatca cctatttaaa agatggtcgc      1320
     ataaatattg ataataatcg cgctgagcgg gctgtgaaac cgtttgtgat aggcagaaaa      1380
     aactggttat tctccaatac cgcgcggggt gcaacggcta gcgccgtgct ctatagtatt      1440
     attgaaaccg cgaaagctaa tggactgttg gtcgacaact atttgcaaac ctgccaagat      1500
     gagcttgcta aaaagcctga aagtgtagag catttgctac cttggaatgt taatcaaggc      1560
     tag                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page