(data stored in ACNUC7421 zone)

EMBL: CR954246.PE395

CR954246.PE395       Location/Qualifiers
FT   CDS_pept        complement(427973..428302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0411"
FT                   /product="putative orphan protein ; putative insertion
FT                   sequence"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF9"
FT                   /protein_id="CAI85509.1"
FT                   /translation="MDNFTASLPLMLKQLKLSTMLQQWNTLGKKAIEEQWSPQQYLSDL
FT                   CHIELATRDDKRLQRLLKDAKLPVGKHLSSFDFTLVDGVSKPLVADLINQPDWLKHGKR
FT                   LSKCV"
     atggataact tcacggcctc gttaccttta atgctgaaac aattaaagct tagcaccatg        60
     cttcaacagt ggaataccct gggaaaaaaa gcgatagaag aacaatggag cccacagcaa       120
     tacttatctg acctgtgcca tattgaactt gcgacacgcg atgataaacg ccttcagcgg       180
     cttttaaaag atgcaaaatt gccagtgggt aaacacctta gcagcttcga ctttaccctt       240
     gttgatgggg ttagtaagcc ccttgttgct gatttaataa atcagccgga ttggttgaag       300
     cacggtaagc gtctgagcaa atgcgtctag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page