(data stored in ACNUC7421 zone)

EMBL: CR954246.PE396

CR954246.PE396       Location/Qualifiers
FT   CDS_pept        complement(428295..429311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0412"
FT                   /product="putative orphan protein ; putative transposase
FT                   (partial)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85510"
FT                   /db_xref="GOA:Q3IIF8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF8"
FT                   /protein_id="CAI85510.1"
FT                   /translation="MPASGWAYAQVIYGGESFAAFSDGVQNAFKAAGGVPKEVRTDSLS
FT                   AAYRNHTNDNDFTERFNELVIHYGFKATRNNRGIAHENGAIESPHGHLKSQLEQALKIR
FT                   GSYDFQTRVVYESFVADIVARRNRRVSDKYAVEQRQLHALPKTMSVSYTEHYLTVSRTS
FT                   TVSLKRVTYSVPSRLIGSRLLVRLYDNRLELRYGSDLVQTLARVYASKGCRARNISYLH
FT                   VIDALVKKPLAFRYSQLRDDLLPSDNYKAIWEYVNAHLLADEASYYMVKLLHLAKQSGC
FT                   ERQLGRFVAASITQRQLPAIRECEAQFLVIASNIPTITIKQHSLSAYSSMIPGGLHG"
     atgcccgcca gtggctgggc ttacgcccaa gtgatttacg gcggtgaaag ctttgctgct        60
     ttttctgatg gcgtgcaaaa cgcatttaaa gcagccggcg gtgtgcctaa agaagtgcgt       120
     acagacagtc tgagtgccgc gtatcgtaat catactaatg ataatgattt tacagagcgc       180
     tttaatgagc tagttatcca ttatggcttt aaagcgaccc gcaataaccg cggtattgcg       240
     catgaaaatg gggctattga gagccctcat gggcatctta aatcgcaact ggagcaagca       300
     ttaaaaatcc gtggtagtta tgactttcag acaagagtag tctatgaatc gtttgttgca       360
     gacattgttg ctcgccgtaa tcgccgtgta agtgataagt acgcagtaga gcagcgacaa       420
     ttacacgctt taccaaagac gatgagcgtc agttacaccg agcattatct aacggtgtca       480
     cgtacgagta ctgtttcatt gaaacgtgtt acctatagcg tcccgtcacg cctgattggt       540
     agccgattac ttgttcgttt atatgacaac cgtttagagc tgcgctatgg cagcgattta       600
     gttcaaacgt tagcgcgtgt ctatgcctct aaagggtgcc gtgcacgtaa tattagttac       660
     ttgcatgtta ttgacgcact ggttaaaaaa ccactggcat ttcgctactc acaactacgt       720
     gacgacttac tcccgagcga caattacaaa gctatctggg aatacgttaa tgcccacctt       780
     ttagcggatg aagcgagcta ttacatggtg aaattgctcc atttagcgaa acaaagtggg       840
     tgtgaacgtc aattaggacg atttgtagca gcgtcaatta ctcagcgaca attaccggcc       900
     atccgagaat gtgaagcgca atttttagtg attgcatcaa acatacccac aataacaata       960
     aagcaacaca gcttgagcgc ttatagcagc atgataccgg gaggtctaca tggataa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page