(data stored in ACNUC7421 zone)

EMBL: CR954246.PE397

CR954246.PE397       Location/Qualifiers
FT   CDS_pept        complement(429278..429769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0413"
FT                   /product="putative orphan protein ; putative
FT                   transposase(partial)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85511"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF7"
FT                   /protein_id="CAI85511.1"
FT                   /translation="MVLSDRHHGITQKRNSQVIAAAKADISERSARRIDKLDEQPLSNK
FT                   RQWRTRIDPLESIWDSIVVPLLQGDATLTPVGIFDHLCEFHTDKFNPSSRRTLERRIHK
FT                   WRALYGSSKEVVFLQTHEYGLLGMCDFTHVKSPVTIASEPLKHMLFIIVCPPVAGLTPK
FT                   "
     atggtattga gcgatcggca tcatggtatt acgcaaaagc gtaatagcca agttatcgcg        60
     gctgcgaaag cagatatttc tgaacgttca gcaaggcgca ttgataaact ggatgagcag       120
     ccattgtcta ataaacgcca atggcgaacg cgtatagatc cacttgaatc tatctgggat       180
     agtattgttg tccccctact tcaaggtgat gcaacgttaa ctccagtggg aatttttgat       240
     catctttgcg agtttcacac cgacaaattt aacccgagtt cacggcgtac attagagcgt       300
     cgaattcata aatggcgggc actgtatggc tcaagtaaag aggtcgtatt cctgcaaaca       360
     cacgagtatg gcctattagg tatgtgtgat tttacacatg tgaagtcacc tgttaccatt       420
     gctagtgaac ccctaaagca tatgttgttc attatcgtat gcccgccagt ggctgggctt       480
     acgcccaagt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page