(data stored in ACNUC7421 zone)

EMBL: CR954246.PE398

CR954246.PE398       Location/Qualifiers
FT   CDS_pept        complement(429814..430287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0414"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85512"
FT                   /db_xref="GOA:Q3IIF6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF6"
FT                   /protein_id="CAI85512.1"
FT                   /translation="MASSSPNILITGATGCGKTYLACALGQNHCQQGSSVYYFRFKELL
FT                   EKMFLAQADGGYRKLINKLSSANLLILDDWGLEPLTAQQRSDLLELIDARYDTKSTLIA
FT                   SQLPIENWYEMIGESTHADAILDRLVHGAIKLELKGESMRKKLNFLTDADHSS"
     atggcttcgt cttcaccaaa catcttgatc acaggagcaa caggttgtgg caaaacttac        60
     ctcgcttgcg cgcttggtca aaaccactgc caacaaggga gtagcgttta ttattttagg       120
     ttcaaagagc tattagaaaa gatgtttcta gcgcaagccg atggtggtta tcgaaaactg       180
     atcaacaagc ttagctctgc caatttactg atcttagatg attggggatt agagccatta       240
     acggctcaac aacggagtga tttactggaa ttaattgatg caagatatga tacaaaatcg       300
     accttaattg cgagtcaatt accgatagaa aattggtatg aaatgatcgg agaatcgaca       360
     cacgcggatg cgattctaga taggcttgtg cacggggcga taaagttgga attaaaaggc       420
     gagtcgatgc gaaaaaaact aaatttcttg actgatgccg atcactcaag ttag             474
//

If you have problems or comments...

PBIL Back to PBIL home page