(data stored in ACNUC7421 zone)

EMBL: CR954246.PE399

CR954246.PE399       Location/Qualifiers
FT   CDS_pept        complement(430260..430577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0415"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85513"
FT                   /db_xref="GOA:Q3IIF5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF5"
FT                   /protein_id="CAI85513.1"
FT                   /translation="MQNINQQVNNQLSNLKLSGIRDALLQQYEQPNLYVEQSFEERLSL
FT                   LLEHEITQRDQRKVDRLTRQAKFRVGGTLAQLNYGAARQLDKAQIRSLAQGEWLRLHQT
FT                   S"
     atgcaaaata tcaatcaaca agttaataat cagttaagta atttaaagct aagcggcata        60
     cgtgatgcgc tattgcagca atacgagcaa cccaatttat acgttgaaca aagcttcgaa       120
     gagcggctaa gtttattgct tgaacatgaa ataacgcagc gtgatcagcg taaagtagat       180
     cgcctaacgc gacaagcaaa gttcagagtt ggcggcacac ttgcccaact caactatggc       240
     gcagcacgac aactcgataa agctcagatc cgttcattag cacaaggtga atggcttcgt       300
     cttcaccaaa catcttga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page