(data stored in ACNUC7421 zone)

EMBL: CR954246.PE40

CR954246.PE40        Location/Qualifiers
FT   CDS_pept        46537..46815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0044"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85154"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF14"
FT                   /protein_id="CAI85154.1"
FT                   /translation="MRATQMAFDLSSEVQKSIKKQAIDQELTPSDMIRKILGLDVKSKK
FT                   TRQRLSFNLNDDEIAQLASRFDVQSDDKRVVKQRVAELLIAHTKKIK"
     gtgcgtgcca cgcaaatggc atttgatcta agtagcgaag tacaaaagtc gataaaaaag        60
     caagcgattg atcaagagct aacaccttca gatatgatcc gcaaaatact cggtttggat       120
     gtaaagtcta aaaaaacccg acagcgtcta tcgtttaatt taaacgacga tgaaatagca       180
     cagcttgcaa gccgttttga tgtgcaaagt gatgataagc gcgtagtaaa gcaacgcgtt       240
     gcagaacttt tgattgctca tacaaaaaaa attaagtag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page