(data stored in ACNUC7421 zone)

EMBL: CR954246.PE400

CR954246.PE400       Location/Qualifiers
FT   CDS_pept        complement(430606..431715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0416"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase (IS408)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85514"
FT                   /db_xref="GOA:Q3IIF3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF3"
FT                   /protein_id="CAI85514.1"
FT                   /translation="MDYCGPTMSIVDTSTGECRTAQVFVAVMGASNYTYAEATYSQKLE
FT                   DWVMSHARCFEFLGGVSELIIPDNLKSAVTKPCRYEPDLNPTYQQLATHYDTVIVPARP
FT                   YKPKDKAKAEVGVQIIERWIMARLRNETFFSLRQLNLKIQALLVNLNQRKMKKHPGSRL
FT                   SQFDAIDRPALKPLPTQPYSYTLVKQVSVHIDYHVEIEKHYYSVPHTLIKQKLEAHASG
FT                   KLVTLYHQGIRVAVHPRSYREGAHTTLDLHMPIAHQKQQQWTPQRFERWASKFGTSTEQ
FT                   FVMQLMQAKKHPEQSYRACMGLLRLGKKFSDQRLEAACHRALTTGVTRVKQVKTILEKG
FT                   LDKQPLPQAQGDLLQDIDHKNIRGNHYYH"
     gtggattact gtggcccaac catgagtatt gttgatacaa gtacaggcga gtgtcgtact        60
     gcacaagtgt tcgttgcggt catgggtgca tcaaattata cctatgccga agcgacttac       120
     agccagaaac tcgaagattg ggtgatgagt cacgcccgtt gttttgagtt tcttggcggt       180
     gtttctgagc taataattcc tgacaacctt aaaagtgccg tcaccaaacc gtgtcgatat       240
     gagcctgact taaacccaac ctaccaacaa ctagcgacac attacgatac ggtcattgtg       300
     cccgctagac cctataaacc aaaggataag gctaaggctg aagtgggtgt gcaaattatt       360
     gaacgttgga taatggcgcg ccttcgcaat gaaaccttct ttagcttgcg tcaattgaac       420
     ctgaaaatac aagcattact ggtcaattta aatcaacgta aaatgaaaaa gcatcctggc       480
     tcacggctca gtcagtttga tgctatcgac agacctgcac tcaaaccact gcccacacag       540
     ccttacagct ataccttagt aaaacaggtg agcgtgcata ttgattatca tgtggaaatt       600
     gaaaagcact actactcagt gccacatacc ttaattaaac aaaagcttga agcccatgcc       660
     tccgggaagt tggtgacact ctaccatcaa ggcatacgag tcgctgttca ccccagatca       720
     taccgagaag gtgcgcacac cacgcttgat ctgcatatgc ctatcgctca tcaaaagcag       780
     caacaatgga caccacagcg gttcgaacgc tgggcgagta aatttggcac atcaactgag       840
     cagtttgtta tgcaattgat gcaagctaaa aaacatccag agcaaagcta ccgtgcttgt       900
     atggggttat taaggctagg taaaaagttt agtgatcaac gtcttgaagc cgcctgtcat       960
     cgcgcattaa ccacaggtgt tactcgcgtt aaacaagtaa agactatctt agaaaaaggc      1020
     ttggataaac aacccttgcc acaagctcaa ggtgatttac tacaagatat tgatcataaa      1080
     aatatccgtg gcaaccacta ttaccattaa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page