(data stored in ACNUC7421 zone)

EMBL: CR954246.PE401

CR954246.PE401       Location/Qualifiers
FT   CDS_pept        complement(431735..432151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0417"
FT                   /product="conserved protein of unknown function; putative
FT                   transposase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85515"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF2"
FT                   /protein_id="CAI85515.1"
FT                   /translation="MPTAPISMRKLKEILRLKYSCKLSHRQIATSLSVSPSIVSKYACK
FT                   SAELDITYWPLDEKWDDHALQQAFFKTKPRLKGFTIPDWSLVQQELRPKTMTLLLLWEE
FT                   YKERHAEGFYSYTHFCRQYKAWLKCQKPSMRQKS"
     atgccaacgg cacctatttc aatgcgtaaa cttaaagaga ttttaagact aaaatacagc        60
     tgtaaactca gtcatcgtca gatagcaaca agcttatctg tttcaccctc aatcgtgtct       120
     aaatatgcct gtaaatcagc agagttagat attacttact ggccgcttga tgagaagtgg       180
     gatgatcacg ctctgcaaca agcgttcttc aaaacaaagc ctcgattaaa aggctttacc       240
     attcctgact ggtcgttagt tcagcaagag cttcggccta aaaccatgac gttgttgctg       300
     ctttgggaag aatacaaaga gcggcacgcg gaaggttttt acagttacac tcacttctgc       360
     cgtcagtaca aggcatggct taaatgccaa aaaccctcca tgcgacaaaa atcataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page