(data stored in ACNUC7421 zone)

EMBL: CR954246.PE403

CR954246.PE403       Location/Qualifiers
FT   CDS_pept        433092..433991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0419"
FT                   /product="putative enzyme with RNA-directed DNA polymerase
FT                   domain"
FT                   /function="3.2 : RNA metabolism"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85517"
FT                   /db_xref="GOA:Q3IIF0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF0"
FT                   /protein_id="CAI85517.1"
FT                   /translation="MAIMKRKVNWVLDLDISKFFDTVEHDWLIKFIEHRIGDKRIIRLI
FT                   RQWIKVGTVDSHGHRQQSTIGTPQGAVISPLLANIYLHYSFDLWLNKQRKYARGNVTII
FT                   RYADDAVLGFQKHQDAIDCQRALTQRLLCFGLKVHPNKTKLIRFGRFAPTQYRENPSRG
FT                   KPGTFDFLGFTHYIGKKLSGEVIVKRKTKRNRQITQLKRIKQALRKRLHDKPWETGRWL
FT                   RRVIQGHINYYGVPYNAHKIGQFVEEVKKLWLKSLRRRSQRHRMTWERFKYYVRYWLPK
FT                   PRIVHPYPEQRFYAKYPR"
     atggcgatta tgaaaagaaa ggtaaactgg gtgttagatt tggacatcag caagttcttc        60
     gataccgtag agcatgactg gctcatcaag ttcatcgaac accgaatagg ggataagcgt       120
     attatccgcc ttatcaggca atggattaaa gttggtactg tcgatagtca tgggcatcgt       180
     cagcagtcaa caatcggaac accacaagga gcagttatct cgccactttt ggcaaatatt       240
     tacctgcact atagtttcga tctctggctt aataagcaac ggaaatatgc gcgaggcaat       300
     gtcacgatca tcagatatgc tgacgatgca gtgttgggtt ttcaaaagca ccaagatgct       360
     attgattgcc agcgggcgct aactcagcga cttttgtgtt ttggtttgaa agtccaccca       420
     aacaaaacta agctgatacg atttggccgt tttgcaccga cgcaatatcg cgagaatcca       480
     tcacgaggta aaccgggaac ttttgatttt ctgggtttta cgcactatat cggcaagaag       540
     ttatccggtg aagttatcgt aaaacgcaag acaaaacgca acagacagat cacccaacta       600
     aaacggataa aacaggcact tcgaaaacga ctccatgata agccctggga aacgggtcgc       660
     tggctacggc gagtgatcca agggcatatt aactattatg gtgtgcctta caatgcccat       720
     aaaatcggtc aatttgttga ggaagtgaag aagttatggt tgaaaagctt aagacgacgt       780
     agtcagcggc accgtatgac ttgggagcga tttaaatact atgtgagata ttggctacca       840
     aaacctagga ttgtacatcc ttatccggaa caacgctttt acgccaaata cccgaggtag       900
//

If you have problems or comments...

PBIL Back to PBIL home page