(data stored in ACNUC7421 zone)

EMBL: CR954246.PE405

CR954246.PE405       Location/Qualifiers
FT   CDS_pept        complement(434383..435537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0421"
FT                   /product="conserved protein of unknown function ; putative
FT                   phage integrase"
FT                   /function="4.4 : Phage-related functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85519"
FT                   /db_xref="GOA:Q3IIE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE8"
FT                   /protein_id="CAI85519.1"
FT                   /translation="MAHIRIRPNGRIQFDLHIYGQRFREGTKLMATPVNIKKANATLKK
FT                   INAEIDLDTFQYRDYFPESKKVAKFEALQRAKDPDRLYPFFNDYANEWFDRQKAKWKSS
FT                   YQSVVRNTLDRYLIPEFGNILVNEIKLANVDYFRESLMVCDTKGARKLSNKRINGILWP
FT                   FVAILSLAAEEHEFTYPLRRYKTLKEERANSLPLTADEVQRFLECTPTQWRDYFTVRFW
FT                   TGMRSCEIHGLRWEDIDFNHRLIRIRHNWVNGELGDVKTPKSRRDLKMCNTLFSLFKRL
FT                   QKQTTSEFVFTHKGKPLDTHFVSTQLWYPTLNKAGLARRRPYETRHTAAVLHIAAHENP
FT                   LYISHMLGHSDTRLLFDVYAPYVANASRQDGFAFNEMMIERGIA"
     atggctcaca ttcgcattcg ccccaatggg cgtattcaat ttgatttaca catttatggg        60
     cagcgctttc gtgaaggcac taagctcatg gcaacccctg ttaatataaa aaaagccaat       120
     gcaacgctta aaaaaatcaa tgctgaaatt gatttagata cgtttcagta ccgtgattat       180
     tttcctgaga gtaaaaaggt cgctaagttt gaagctttgc aacgggctaa agatcccgat       240
     cgcctttatc cgttttttaa cgattacgcg aacgaatggt tcgatcgcca aaaagcaaaa       300
     tggaaaagca gttaccaaag cgtggtacgt aatacgctcg accgttacct tattcctgaa       360
     tttggcaata tattagttaa tgagatcaag ttggctaatg tggactattt tcgcgaaagc       420
     ttaatggtgt gcgataccaa aggggcccgt aaactttcta ataaacgaat taacggtatt       480
     ttatggccgt ttgtcgctat tttgagttta gctgccgaag agcatgaatt tacttaccca       540
     ttacgccgct ataaaacctt aaaagaagaa cgcgccaatt cactgccact gaccgcagat       600
     gaagtacaac gctttttaga atgtacccct acacaatggc gtgattattt tacggtgcgt       660
     ttttggaccg gtatgcgtag ctgtgaaata cacggcctac gctgggaaga tatcgacttt       720
     aatcatcgcc ttattcgtat tcgtcacaat tgggtaaatg gtgaactcgg ggatgtaaaa       780
     acacctaagt cgcgccgcga cttaaaaatg tgtaatacac tcttttcgct atttaaacgc       840
     ttacaaaaac aaacaaccag tgaatttgtg tttactcaca aaggcaaacc gcttgatacc       900
     cactttgtaa gcactcaact gtggtacccc acacttaata aagcggggct tgcacgccgc       960
     cgaccttacg aaactcgcca taccgctgct gtactgcata tcgcagcaca tgaaaaccca      1020
     ctctacattt cacacatgct gggccacagc gacacacgtt tattgtttga cgtatacgca      1080
     ccctatgttg ccaatgcgtc aaggcaagat ggttttgcgt ttaatgaaat gatgattgaa      1140
     cgggggatag cttga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page