(data stored in ACNUC7421 zone)

EMBL: CR954246.PE406

CR954246.PE406       Location/Qualifiers
FT   CDS_pept        complement(435971..437257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0422"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE7"
FT                   /protein_id="CAI85520.1"
FT                   /translation="MKIIIPKEKKQLLKNTTIHIDTSYSDSLATVLTNKKERSLTLVTG
FT                   QKPLFAHCVFILDKGSTNLKDKQFSIDGSYAKQLPHYFTSEQDIELNFQASSADSSFIE
FT                   LIQTDLKDNEATLRRCECSDASKEHLTYLKDNKQLPTTTVSKAVIERVIFESTGHMPYQ
FT                   FIELDSDKQHIRVQRDGKVEKKYLPKDIKLPVSIVMTQEITYKLFDFCKTINGDKIEMV
FT                   QQGELLTFKTDESSVTSTLTGLNEFYTKTPEKTETLRFVELDFYEFKAELRHCFKEYGV
FT                   IKKANDALLYLSDKKAAIAVFTEPYKFVHPFTVSKIDNKKDNVNSIFRFSPKDLLNIKI
FT                   KDLIGAKSTRLEVIEYSNGEIKLGVYYSLEDKLPYLSIPIEKDKSQLPKVLAMLESLDK
FT                   NQHKTQHKKQEIQGDLFGSDMGEGEEDEY"
     atgaaaatta ttattcctaa agagaaaaaa caactactta aaaacacaac tatacatatt        60
     gatactagct attctgacag cctagcaacc gtattaacaa acaaaaaaga gcgctcttta       120
     acgttagtca ccgggcaaaa accgctgttt gcgcattgtg tgtttatact tgataaaggc       180
     tctactaact taaaagataa acagttttct attgatggta gttacgccaa gcagcttcct       240
     cactatttta catcagagca agacattgaa ttaaattttc aagcttcgtc agcagactct       300
     tcttttatag agttgattca aactgatctc aaagacaatg aggcaacatt gcgccgatgt       360
     gaatgcagcg atgcatctaa ggagcattta acttacctta aagataacaa acagctccca       420
     accacaaccg tctccaaagc agttattgaa cgtgttattt ttgaatctac tgggcatatg       480
     ccctatcagt ttattgagct agatagtgat aaacaacata ttcgtgtgca acgtgatggt       540
     aaagtagaaa aaaaatattt accaaaagac ataaagttac ctgtttctat agttatgacc       600
     caagaaatta cttataagtt gtttgatttt tgcaaaacta taaacggtga taaaattgag       660
     atggtccaac aaggggagtt gctcaccttt aaaacagatg agagctcggt aacctccact       720
     ttaacagggc ttaacgagtt ttacacaaaa acccctgaaa aaacagaaac tttgaggttc       780
     gttgaactag atttttatga atttaaagca gaacttagac attgttttaa agaatatggg       840
     gtcattaaaa aagcgaatga tgcattattg tatttaagtg ataaaaaagc tgcgatcgct       900
     gtattcacag aaccttataa atttgtccac ccttttactg tatcaaagat tgataacaaa       960
     aaagataatg ttaactcaat ctttcgcttt tcaccgaaag atttactaaa tataaaaatc      1020
     aaagatttaa tcggcgctaa aagtacgcga ttagaggtta ttgaatattc aaatggtgaa      1080
     attaagctag gagtatatta ttcactagaa gataaattgc cttatcttag tatcccgatt      1140
     gaaaaagaca agagccagct acctaaagtg ttagctatgc ttgaaagctt ggataaaaac      1200
     caacataaaa cgcaacataa aaagcaagaa atacagggag atctatttgg ttctgatatg      1260
     ggtgaggggg aggaggatga gtattaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page